KEGG   Rattus norvegicus (rat): 170945
Entry
170945            CDS       T01003                                 

Gene name
Chrna2, ACHR
Definition
(RefSeq) cholinergic receptor nicotinic alpha 2 subunit
  KO
K04804  nicotinic acetylcholine receptor alpha-2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    170945 (Chrna2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    170945 (Chrna2)
Ion channels [BR:rno04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   170945 (Chrna2)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD DUF2417
Other DBs
NCBI-GeneID: 170945
NCBI-ProteinID: NP_596911
RGD: 621533
Ensembl: ENSRNOG00000017424
UniProt: P12389
Position
15p12
AA seq 511 aa
MTLSHSALQFWTHLYLWCLLLVPAVLTQQGSHTHAEDRLFKHLFGGYNRWARPVPNTSDV
VIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWDPAEFGNVTSLRVPSEMIWIP
DIVLYNNADGEFAVTHMTKAHLFFTGTVHWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGS
WTYDKAKIDLEQMERTVDLKDYWESGEWAIINATGTYNSKKYDCCAEIYPDVTYYFVIRR
LPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSL
VIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHNMPNWVRVALLGRVPRWLMMNRP
LPPMELHGSPDLKLSPSYHWLETNMDAGEREETEEEEEEEDENICVCAGLPDSSMGVLYG
HGGLHLRAMEPETKTPSQASEILLSPQIQKALEGVHYIADRLRSEDADSSVKEDWKYVAM
VVDRIFLWLFIIVCFLGTIGLFLPPFLAGMI
NT seq 1536 nt   +upstreamnt  +downstreamnt
atgaccctttcccattctgctctccagttctggacacatctttatctctggtgtctcctt
ctggtgccagcagtgttgacccagcaaggctcacacacccatgctgaggaccgcctgttc
aaacacctgtttggaggctacaatcgctgggcacggccagtgcccaacacttctgatgtg
gtcatcgtgcgctttggattatccattgctcagctcatagatgtggatgagaagaatcaa
atgatgaccaccaatgtctggctaaagcaggaatggaatgactacaagctgcgctgggac
ccggctgagtttggcaatgtcacctccctgcgcgtcccttcagagatgatctggatccca
gacattgtcctctacaacaatgcagatggggagtttgcggtgacccacatgaccaaggct
cacctcttcttcacgggcactgtgcactgggtgcccccagccatctacaagagctcctgc
agcatcgatgtgaccttcttccccttcgaccagcagaactgcaagatgaagtttggctcc
tggacatatgacaaggccaagatcgatctggagcagatggagaggacagtggacctgaag
gactactgggagagtggcgagtgggccattatcaatgccaccggaacctataacagtaag
aagtacgactgctgcgcggagatctaccccgatgtcacctactactttgtgatccgccgg
ctgccgctgttctataccatcaacctcatcatcccatgcctgctcatctcctgcctcact
gtgctcgtgttctacctgccttccgagtgtggagagaagatcacgctgtgcatctcggtg
ctgctatctctcactgtcttcctgctgctcatcacggagatcatcccgtccacctcgctg
gtcatcccactcatcggcgagtacctgctcttcaccatgatctttgtcaccctctctatc
gttatcacagtcttcgtgctcaatgtacaccaccgctcccccagcacccacaacatgccc
aactgggtaagggtagccctgctaggccgggtgcccaggtggctgatgatgaaccggccc
ctgccacctatggagctccatggctccccggatctgaagctcagcccctcataccattgg
ctagagactaacatggatgctggagaaagggaggagacagaggaagaggaggaagaagaa
gatgaaaacatatgtgtgtgtgcaggccttccagactcttcgatgggtgtcctctatggc
catggcggcctgcatctgagagccatggagcctgagaccaagactccatcccaggctagc
gagattctgctgtcacctcaaatacagaaagcactagaaggtgtacactacattgctgac
cgtctgaggtctgaggatgctgactcttcggtgaaggaagactggaagtatgtggccatg
gtggtagaccggatattcctctggctgttcattatcgtctgcttcctggggaccatcgga
ctcttccttcctccattcctggctggaatgatctaa

DBGET integrated database retrieval system