KEGG   Rattus norvegicus (rat): 171009Help
Entry
171009            CDS       T01003                                 

Gene name
Actn3
Definition
(RefSeq) actinin alpha 3
  KO
K21073  actinin alpha 2/3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    171009 (Actn3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    171009 (Actn3)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    171009 (Actn3)
   04147 Exosome [BR:rno04147]
    171009 (Actn3)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    171009 (Actn3)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     171009 (Actn3)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   171009 (Actn3)
  Exosomal proteins of colorectal cancer cells
   171009 (Actn3)
  Exosomal proteins of bladder cancer cells
   171009 (Actn3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Spectrin CH EFhand_Ca_insen CAMSAP_CH EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8
Motif
Other DBs
NCBI-GeneID: 171009
NCBI-ProteinID: NP_596915
RGD: 621792
Ensembl: ENSRNOG00000019745
UniProt: Q8R4I6
Position
1q43
AA seq 900 aa AA seqDB search
MMMVMQPEGLGAGEGPFSGGGGGEYMEQEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRK
AGTQIENIEEDFRNGLKLMLLLEVISGERLPRPDKGKMRFHKIANVNKALDFIASKGVKL
VSIGAEEIVDGNLKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNVQ
NFHTSWKDGLALCALIHRHRPDLIDYAKLRKDDPIGNLNTAFEVAEKYLDIPKMLDAEDI
VNTPKPDEKAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENEKLMEEYEKLASELL
EWIRRTVPWLENRVGEPSMSAMQRKLEDFRDYRRLHKPPRVQEKCQLEINFNTLQTKLRL
SHRPAFMPSEGKLVSDIANAWRGLEQVEKGYEDWLLSEIRRLQRLQHLAEKFQQKASLHE
AWTRGKEEMLNQHDYESASLQEVRALLRRHEAFESDLAAHQDRVEHIAALAQELNELDYH
EAASVNSRCQAICDQWDNLGTLTQKRRDALERMEKLLETIDQLQLEFARRAAPFNNWLDG
AIEDLQDVWLVHSVEETQSLLTAHEQFKATLPEADRERGAILGIQGEIQKICQTYGLRPK
SGNPYITLSSQDINNKWDTVRKLVPSRDQTLQEELARQQVNERLRRQFAAQANAIGPWIQ
GKVEEVGRLAAGLAGSLEEQMAGLRQQEQNIINYKSNIDRLEGDHQLLQEGLVFDNKHTV
YSMEHIRVGWEQLLTSIARTINEVENQVLTRDAKGLSQEQLNEFRASFNHFDRKRNGMME
PDDFRACLISMGYDLGEVEFARIMTMVDPNAAGVVTFQAFIDFMTRETAETDTAEQVVAS
FKILAGDKNYITPEELRRELPAEQAEYCIRRMAPYKGSGAPSGALDYVAFSSALYGESDL
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atgatgatggttatgcagcccgagggtctgggggccggggaggggcccttctctggtggc
gggggcggtgagtacatggaacaggaggaagactgggaccgcgacttgctgttggatcct
gcctgggagaaacagcagcggaaaaccttcactgcatggtgcaactcccatctgcgcaag
gcaggcacacagatcgagaacattgaagaggacttccgcaatggcctgaagctcatgctg
ctcctggaggtcatttctggagagaggctgcccaggccagacaaaggcaagatgcgcttc
cacaaaatcgccaatgtcaacaaagccctggacttcattgccagcaaaggagttaagcta
gtgtccatcggtgctgaagaaattgttgacgggaacctgaagatgaccctgggcatgatc
tggaccatcatcctccgctttgccattcaggacatctctgtagaagagacctcagccaaa
gaaggcttgcttctctggtgtcagcggaaaacagcaccataccgcaatgtcaacgtacag
aacttccataccagctggaaggatggcctggccctctgtgctctcatccaccgccaccgg
ccagatctcattgactatgccaagcttcgcaaggatgaccccattggaaacctgaacact
gcctttgaggtggcagagaaatacctggacatccctaagatgctggatgcagaagatatt
gtgaacacccccaaaccagatgagaaagccatcatgacctatgtttcctgcttctaccat
gcatttgctggggctgagcaggcagagactgctgccaacaggatctgcaaggtcttagct
gtgaaccaggaaaacgagaagctgatggaggagtatgagaaactggctagtgagctgttg
gagtggatccgccgcactgtcccatggctagagaaccgagtgggtgaacccagcatgagt
gccatgcagcgcaagctggaggacttccgcgactacaggcgcctgcacaagcctccccgt
gtgcaggagaagtgccagctggagatcaacttcaacacgctgcagaccaagctgcgcctg
agccaccgacctgctttcatgccctcagagggcaagctggtttcggacatagccaatgcg
tggcggggactggagcaggtggagaagggctatgaggactggctgctttcagagatcagg
cgtctgcagaggcttcagcacctggctgagaagttccagcagaaggcttccctgcatgaa
gcttggacccggggcaaagaggaaatgttaaaccagcatgactacgagtcagcttcgctg
caggaggtgcgtgcgctcttgcgacgtcatgaggcctttgagagcgacttggctgcacat
caagaccgggtggaacacattgcagccctggcccaggaactcaatgagctggactaccat
gaggcagcctcggtgaatagccgctgccaagccatctgcgaccagtgggataacttgggt
acactgacccagaagaggagggatgcactagagagaatggagaagctcctggaaaccatt
gaccagctgcagctggagtttgctcggcgggcagcgcccttcaacaactggctggatggg
gctattgaggacctgcaggatgtgtggctagtgcactctgtagaagagacgcagagcctg
ctaacagcacatgaacagttcaaggcaacgttgcctgaggcggatcgagagcgaggtgcc
atcctgggcattcaaggagagattcagaagatctgtcagacgtatggactgcggccaaag
tctggcaacccctacatcaccctcagctcgcaggacatcaacaataagtgggacacggtc
agaaagctggtacccagccgtgaccagacactgcaggaggagctggcccggcagcaggtg
aatgagaggctccggcgacagtttgcagcccaggccaatgccataggaccctggatccag
ggaaaggtggaggaagtagggcggctggcagctgggctggctggctctctggaggagcag
atggcaggtctgcgacagcaggagcagaacatcatcaattacaagagcaacatcgaccgg
ctggagggtgaccaccagctgctgcaggagggcctagtctttgacaacaagcacacggtc
tacagcatggagcacatccgtgtgggctgggagcagctgctcacctccattgcccgcacc
atcaatgaggtggagaaccaggtactgacccgagatgccaagggcctgagccaggaacag
ctcaacgagttccgggcatctttcaaccactttgaccggaagcggaatgggatgatggaa
cctgatgatttccgagcttgcctcatctccatgggctatgatctgggagaggtggagttt
gctcggatcatgaccatggtggaccccaatgcagctggggtcgtgaccttccaagccttc
attgacttcatgacccgagagactgcagagacagacacagctgaacaagttgtagcctcc
ttcaaaatcctagcaggagacaagaactacattaccccagaagagctgcggagggagctc
ccagccgagcaggctgagtactgcatccgtcggatggcaccctacaaaggatcgggggct
ccgtccggggccctggactacgtggctttctctagtgccctctacggagagagtgacctc
tga

DBGET integrated database retrieval system