KEGG   Rattus norvegicus (rat): 171016
Entry
171016            CDS       T01003                                 

Gene name
Hrg, HPRG, HRG1
Definition
(RefSeq) histidine-rich glycoprotein
  KO
K23410  histidine-rich glycoprotein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    171016 (Hrg)
Peptidases and inhibitors [BR:rno01002]
 Peptidase inhibitors
  Family I25: cystatin family
   171016 (Hrg)
SSDB
Motif
Pfam: Cystatin
Other DBs
NCBI-GeneID: 171016
NCBI-ProteinID: NP_596919
RGD: 619808
Ensembl: ENSRNOG00000001809
UniProt: Q99PS8
Position
11q23
AA seq 525 aa
MKVLTTALLLVTLQCSHALSPTNCDASKPLAEKVLDLINKGRRSGYTFQLLRVSDAHLDR
VETATIYYLVLDVVESDCWVLSTKAQDECLPAMRTSEVVIGQCKVIATRYSNESQDLSVN
GYNCTMRSVSSAYINTKDSPVLVDSFEDSEPYRKLARKALDKYKAENGDFASFRVERAER
VIRMRGGERTSYFIEFSVRNCSTQHFPRHPPVFGLCRVVLTYSTEASDLETPEYTDLICE
VFNTEDLKNRSDMKPHRGHEHPHCDKHLCKLSGPRDHHHTHKTHEIGCPPPPEGKDNSDR
PPLQEGALPQMLPGHSGPSGTNRSHRPPHNHSCNEHPCHGQHPHGHHPHGQHPHGHHPHG
QHPHGHHPHGQHPHGHHPHGQHPHGHHPHGHHPHGDHPHGHHPHGHDFLDYGPCDPPSNS
QELKGQYHRGHGPPHGHSRKRGPGKGLFPFHQRQIGYVYRLPPLNVGEVLTPPEANFPIF
SLPNCNRPPQPEIRPFPQTASKSCPGKFEGKFPQVSNFFEHTPPK
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgaaggtgctcaccacggcattgcttctagtcaccctgcagtgttcccatgccctgagt
cccaccaactgtgatgcctccaagcctttggctgagaaagttctagacttgatcaataaa
gggcggaggagtggctatacttttcagctgctgcgggtctctgatgcccacttggacaga
gtggaaactgccaccatctactacttagttttagatgtggtagaatctgactgttgggtc
ctctccacaaaagcccaggatgagtgtcttccagccatgaggacatctgaggttgtgatt
ggacagtgtaaggtaatagccacaagatactccaatgagtctcaagatcttagcgtgaat
ggctataactgcaccatgagatccgtctcttcggcatatatcaacaccaaagacagtcct
gtactagtggactcatttgaggattccgagccctacagaaagctagcccgtaaagccctc
gacaagtacaaagcggagaatggtgactttgcctcattcagagtggaaagggctgaaagg
gttataagaatgagaggaggggaaagaaccagctacttcatagaattctcggtgaggaac
tgttccacacaacacttccccagacaccctccggtctttggattgtgcagagtagttttg
acctacagtacagaagcctctgacttggaaaccccagaatacactgacctgatctgtgaa
gtcttcaacactgaggatcttaaaaacaggagtgacatgaaaccccatcggggccatgag
catcctcattgtgacaaacatctgtgtaagctcagtggacccagggaccatcatcatacc
cataagacacatgaaattggatgcccaccaccaccagaaggaaaagataactcagacaga
ccaccccttcaagaaggagcccttccacaaatgctccctggccattctggtccttctggt
accaacaggagccatagaccccctcataatcacagttgtaatgagcatccgtgccatgga
cagcatccccatggacaccaccctcatggtcagcatccccatggacaccaccctcatggt
cagcatccccatggacaccaccctcatggtcagcatccccatggacaccaccctcatggt
cagcatccccatggacaccacccccatggtcaccatcctcatggtgaccatccccatgga
caccacccccatggacatgatttccttgactatggaccttgtgacccaccctccaatagc
caagaactcaagggtcagtatcatcggggacatggtccaccacacggacactcaaggaaa
agagggccaggtaaaggactctttcctttccaccaacgacaaatcggatatgtctaccga
ctccctccactgaatgtaggtgaagttctcactcctcctgaagccaatttccccatcttc
tctttgccaaattgcaacagacccccacaaccagagattcggcccttccctcagacagcc
tcaaagtcctgtccagggaaatttgagggtaagtttccacaagtttccaacttttttgaa
catacgcctccaaaataa

DBGET integrated database retrieval system