KEGG   Rattus norvegicus (rat): 171026Help
Entry
171026            CDS       T01003                                 

Gene name
Akap5, AKAP150, Akap79, P150
Definition
(RefSeq) A-kinase anchoring protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:rno01009]
    171026 (Akap5)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     171026 (Akap5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WSK
Motif
Other DBs
NCBI-GeneID: 171026
NCBI-ProteinID: NP_598199
RGD: 620829
Ensembl: ENSRNOG00000006410
UniProt: F1LPP6
Position
6q24
AA seq 714 aa AA seqDB search
METSVSEIQIETKDEKRPEAASPQKERQERKTATLCFKRRKKVNKKKAKAGSKTAEETKK
HAPEAGGSGQRQPAGAWASIKRLVTHRKPSESAEKQKPSEAEMQPEDGALPKKKTKSKLK
IPCIRFSRGAKRSRPSKLTEDSGYVRVQGEADDLEIKAQIQPDEQATQAKSTQGLQEDVM
VRDGKEIQESHISNNVISGEHVIAIELELEKESSALRMRTPGSEKEAKVILVKQSVQVQQ
ASVLENSAADSPQPVTSTAPLSPATTHQLGLEEPSDSIRESAPSGKDDGRRKTAAEEKKS
GETALGQAEEASSVSQADKSVLSQAEEATVGHTEEATVIQAQSQAKEGKLSQAEEATVAQ
AKETVLSQAEEVKLSQIEEPAISQAKKATVGQAKEAIVSQAEEAIVGHTEKATMGQAEEA
TVGHIEKTTVGQAEEATVGQAEEATVGQAEEATVGQAEEATVGQAEEATVGQAGEATVSH
IEKTTVGQAEEAIVGQAEEATVGQAEEATVGQAEEATVGQAEEATVDQAEEATVGQAEEA
TVGQAGEAAVGQAEEAIVAQAEEATVGQAGEATVGQAEKATVGQAEEPIVGQAEETVLRH
ASDLKVNGVDAEKPRSEESKRMEPIAIIITDTEISEFDVKKSKNVPKQFLISMENEQVGV
FANDSDFEGRTSEQYETLLIETASSLVKNAIELSVEQLVNEMVSEDNQINTLFQ
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggagaccagcgtttctgagattcaaatcgagactaaggatgagaagagaccagaagca
gccagtcctcagaaagagaggcaggagagaaaaacagccacactgtgcttcaagagaagg
aagaaagtgaacaagaagaaggccaaagctggttccaagactgctgaggagacaaagaag
catgccccagaagctgggggttctggtcagcggcaaccagcgggggcctgggcctccatt
aaacgccttgtgacacacaggaaaccgtccgagtctgcagagaagcagaagccatctgag
gctgaaatgcagcctgaggatggagctcttcctaagaagaagacaaaatccaaacttaag
attccttgcatacgattctcaagaggggcaaagagaagtcgtccttccaaactcacagaa
gattcaggctatgtccgagtccagggagaggcagacgatttggagataaaagcccagatc
cagcccgatgagcaggcaacccaggctaagtccacccagggcctacaggaagatgtgatg
gtgagagatggtaaggagatccaagaatcacacataagcaacaacgtcatatcgggagag
catgtgattgccatagaactggaattagaaaaggaatcttctgctctccggatgagaact
ccagggagtgaaaaggaggctaaagtgattctggtaaagcagagtgttcaggtacagcaa
gcaagtgtgcttgagaattcagcagcagacagccctcagccagtgacttctactgctcct
ctctcaccagcaaccacacatcaactcggtctggaagaacccagtgacagcatccgggaa
agtgcaccaagtggaaaagatgacggaaggagaaagactgctgctgaagaaaagaaatca
ggagagactgcgctgggccaggcagaggaggcttcttcagtcagccaggcagacaaaagt
gtactaagccaggcagaagaagctacagtgggccacacagaggaagctactgtgatccag
gcacagagtcaggcaaaggaaggtaaactgagccaggcagaggaagctacagtggcccag
gcaaaggaaactgtattgagtcaggcagaggaagttaaactgagccagatagaagaacct
gcaattagccaggcaaagaaagctacagtaggacaagcaaaggaagctatagttagccag
gcagaggaagctatagttggtcacacagagaaagccaccatgggtcaggcagaggaagct
acagttggccacatagagaaaaccacagtgggccaggcagaggaagctacagtgggtcaa
gcagaggaagccacagtgggtcaagcagaggaagccacagtgggtcaagcagaggaagct
acagttggacaggcagaggaagctacagttggtcaggcaggggaagctacagttagccac
atagagaaaaccacagtgggccaggcagaggaagctatagttggtcaggcagaggaagcc
acagtgggtcaagcagaggaagccacagtgggtcaagcagaggaagctacagttggccag
gcagaggaagccacagtggatcaagcagaggaagctacagttggccaggcagaggaagct
acagttggtcaggcaggggaagctgcagttggccaggcagaggaagctatagttgctcag
gcagaggaagccacagttggtcaggcaggggaagctacagttggccaagcagagaaagcc
acagttggccaagcagaggaacccatagttggccaggcagaggaaactgtattgaggcat
gcatcagatctgaaagtaaatggagttgatgcagagaaaccaagatcagaagaaagcaaa
agaatggagccaattgctattatcataacagacactgaaatcagtgaatttgatgttaag
aaatctaaaaatgtccctaagcaattcctaatttccatggaaaatgagcaagtgggggtt
tttgctaatgatagtgatttcgaggggagaacttcagaacagtatgaaacactcttaata
gaaacagcttcttctctcgtcaagaatgctatcgagttgtctgtagaacagctggttaac
gaaatggtttctgaggataatcaaataaatacgctgttccagtga

DBGET integrated database retrieval system