KEGG   Rattus norvegicus (rat): 171040
Entry
171040            CDS       T01003                                 

Gene name
Il11, Il-11
Definition
(RefSeq) interleukin 11
  KO
K05417  interleukin 11
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04630  JAK-STAT signaling pathway
rno04640  Hematopoietic cell lineage
rno05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    171040 (Il11)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    171040 (Il11)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    171040 (Il11)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    171040 (Il11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    171040 (Il11)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Interleukins
   171040 (Il11)
SSDB
Motif
Pfam: IL11
Other DBs
NCBI-GeneID: 171040
NCBI-ProteinID: NP_598203
RGD: 621475
Ensembl: ENSRNOG00000017386
UniProt: G3V890
Position
1q12
AA seq 199 aa
MNCVCHLVLVVLSLWPDRVVAPGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQM
RDKFPADGDHNLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYFRHVQWLRRAAGPSLK
TLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPAVPLGPPASAWGSIRAAHAILGG
LHLTLDWAVRGLLLLKTRL
NT seq 600 nt   +upstreamnt  +downstreamnt
atgaactgtgtttgtcacctggtcctggtggtgctgagcctctggccagatagagtcgtt
gcccctgggccaccagctggctcccctcgagtgtcttcagaccctcgtgcagatctggat
agcgctgtcctcttgaccaggtccctcctggcagacacacggcaactagctgcacagatg
agagacaaattcccagctgatggagaccacaatctggactccctacctaccttggccatg
agcgctgggacactgggatctttgcagcttcctggagtgctgacaaggcttcgagtagac
ttaatgtcctacttccgacatgtacagtggttgcgccgggcagctggtccttccctaaag
actctggagccagagctgggtgccctgcaagcccgactggaacggctacttcgtcgctta
cagctcttgatgtctcgcctagccttgccccaggcagccccggaccaacctgcggtccct
ctgggccctcctgcctcggcctggggaagcatccgggcagctcatgccatcctaggaggg
ctgcacctgaccttggactgggccgtgcggggcctgctgttgttaaagactcggctgtaa

DBGET integrated database retrieval system