KEGG   Rattus norvegicus (rat): 171041Help
Entry
171041            CDS       T01003                                 

Gene name
Klc1, Kns2
Definition
(RefSeq) kinesin light chain 1
  KO
K10407  kinesin light chain
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09167 Infectious diseases
   05132 Salmonella infection
    171041 (Klc1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:rno03019]
    171041 (Klc1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    171041 (Klc1)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     171041 (Klc1)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     171041 (Klc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_12 TPR_10 TPR_7 TPR_1 TPR_2 TPR_16 TPR_8 TPR_19 TPR_14 TPR_17 ANAPC3 PPR JIP_LZII TMF_TATA_bd GHL5 DUF4919 COG2
Motif
Other DBs
NCBI-GeneID: 171041
NCBI-ProteinID: NP_001075443
RGD: 621411
Ensembl: ENSRNOG00000011572
Vega: OTTRNOG00000002307
UniProt: P37285
Position
6q32
AA seq 560 aa AA seqDB search
MHDNMSTMVYMKEEKLEKLTQDEIISKTKQVIQGLEALKNEHNSILQSLLETLKCLKKDD
ESNLVEEKSSMIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWL
RDELANTQQKLQKSEQSVAQLEEEKKHLEFMNQLKKYDDDISPSEDKDSDSSKEPLDDLF
PNDEDDPGQGIQQQHSSAAAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQAL
EDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGRDHPAVAATL
NNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEY
YYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVD
DENKPIWMHAEEREECKGKQKDGSSFGEYGGWYKACKVDSPTVTTTLKNLGALYRRQGKF
EAAETLEEAALRSRKQGLDNVHKQRVAEVLNDPENVEKRRSRESLNVDVVKYESGPDGGE
EVSMSVEWNGMRKMKLGLVK
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgcatgacaacatgtccacaatggtgtacatgaaggaagagaagctggagaagcttacg
caggatgaaatcatttctaagaccaagcaggtgatccaggggctggaggccctgaagaat
gagcacaactccatcctgcagagtctgctggagacgctgaagtgcttgaagaaggacgat
gagagcaacctggtggaggagaagtccagcatgatccgcaagtccttggagatgctggag
ctcggcctgagcgaggcgcaggtgatgatggccctgtctaatcacctgaatgccgtggag
tccgagaagcagaagctccgagctcaggttcgacgtctgtgccaggagaaccagtggctg
cgggatgaactggccaacacacagcagaagttacagaagagcgagcagtccgtggctcag
ctggaggaggagaagaagcacctggagttcatgaaccagctgaagaaatacgacgacgac
atctctccctcggaagacaaagactctgattcttccaaagagccgttggatgacctcttc
ccgaatgatgaggatgacccaggacaaggaatccagcagcaacacagcagtgctgcggcc
gccgcccagcagggcggctacgagatccctgcccggctgcgcacgctccacaacctggtg
atccagtatgcctcgcaggggcgttacgaggtggcggtgccactctgcaagcaggccctg
gaggacctggagaagacttccggccacgaccaccctgatgtggccaccatgctcaacatc
ctggccctggtgtacagggatcagaacaagtataaagacgcagcaaacctcctgaacgat
gccctggctatccgtgagaaaaccctgggccgagatcaccctgcggtggctgcgaccctc
aacaacctagcagtgctgtacggtaagcgtggcaagtacaaagaggccgagccgctgtgc
aaacgggccctggagatcagggagaaggttctgggaaaggatcaccctgatgttgctaag
caactaaataatctggccttgctgtgccagaaccagggcaagtacgaggaggtggagtat
tactaccagagggccctggagatctaccagacgaagctcggacccgatgatcccaacgtg
gccaagacgaagaataacctggcttcctgttatctgaaacaagggaagttcaaacaagca
gaaacattgtacaaggagattctcacccgcgcacatgaacgggagtttggatctgtggat
gatgaaaacaagcccatatggatgcacgcggaggagagagaggagtgcaaaggaaagcag
aaggacgggtcgtcttttggagagtatggcggctggtataaggcctgcaaagtggacagt
cccaccgtcacaaccaccttgaaaaacctgggagcactttaccgccgccaggggaagttt
gaagctgcggagacactggaggaagctgccctgaggtcacgtaagcagggtcttgacaat
gttcacaaacagagagtggctgaagtgctaaatgaccctgagaacgtggagaagcggagg
agccgggagagcctcaatgtggacgtggtcaagtacgagagtggccctgacggaggggag
gaagtgagtatgagcgtagagtggaatgggatgagaaagatgaagctcgggctggttaaa
tga

DBGET integrated database retrieval system