KEGG   Rattus norvegicus (rat): 171044Help
Entry
171044            CDS       T01003                                 

Gene name
Sstr3, SSTR, Smstr28
Definition
(RefSeq) somatostatin receptor 3
  KO
K04219  somatostatin receptor 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    171044 (Sstr3)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    171044 (Sstr3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    171044 (Sstr3)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Somatostatin
    171044 (Sstr3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srv 7tm_4 Serpentine_r_xa
Motif
Other DBs
NCBI-GeneID: 171044
NCBI-ProteinID: NP_598206
RGD: 620308
Ensembl: ENSRNOG00000007332
UniProt: P30936
Position
7q34
AA seq 428 aa AA seqDB search
MAAVTYPSSVPTTLDPGNASSAWPLDTSLGNASAGTSLAGLAVSGILISLVYLVVCVVGL
LGNSLVIYVVLRHTSSPSVTSVYILNLALADELFMLGLPFLAAQNALSYWPFGSLMCRLV
MAVDGINQFTSIFCLTVMSVDRYLAVVHPTRSARWRTAPVARMVSAAVWVASAVVVLPVV
VFSGVPRGMSTCHMQWPEPAAAWRTAFIIYTAALGFFGPLLVICLCYLLIVVKVRSTTRR
VRAPSCQWVQAPACQRRRRSERRVTRMVVAVVALFVLCWMPFYLLNIVNVVCPLPEEPAF
FGLYFLVVALPYANSCANPILYGFLSYRFKQGFRRILLRPSRRVRSQEPGSGPPEKTEEE
EDEEEEERREEEERRMQRGQEMNGRLSQIAQPGPSGQQQRPCTGTAKEQQLLPQEATAGD
KASTLSHL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggccgctgttacctatccttcatccgtgcctacgaccttggaccctgggaatgcatcc
tcagcctggcccctggacacgtccctggggaatgcatctgctggcactagcctggcagga
ctggctgtcagtggcatcttgatctctctggtgtacctggtggtgtgtgtggtgggtttg
ctgggcaattcactggtgatctacgtggttctgcggcacacgtccagcccatcagtgacc
agtgtctatatcctcaacctggcactggctgacgaactcttcatgctggggctacctttc
ctggctgctcagaacgccctgtcctactggcctttcggctctctcatgtgtcgtctggtc
atggccgtggatggcatcaaccagttcaccagcatcttctgcctcaccgtcatgagtgtg
gaccgctacctggctgtggtgcaccccacacgctctgcccgctggcgcacggcacctgtg
gctcgaatggtcagtgcagctgtctgggtggcctcagctgtggtcgtgctgcctgtggtt
gtgttctcaggagtgccccgagggatgagcacgtgccacatgcagtggccagagccagcg
gctgcctggcgaacagccttcatcatctatacggccgcactgggcttttttgggcccctg
ctggtcatctgcttatgctacctgcttattgtggtgaaggtgcggtcgaccacacggcgg
gtgcgggcgccctcgtgccagtgggtacaggcacccgcttgccagcggcggcggcgctct
gagcgcagggtgacacgcatggtggtggctgtggtggcactcttcgtcctctgctggatg
cctttctatttactcaacatcgttaatgtggtgtgcccgctgccggaggagcccgccttc
tttggcctctacttcctggtggtcgcgctgccctacgccaacagctgcgcaaaccccatc
ctctacggcttcctctcctaccgcttcaagcagggcttccgcaggatcctgctaagacct
tctcggcgagtacggagccaggagccagggtctggccctccagagaagacggaggaggag
gaggatgaagaggaagaagagagaagggaagaggaagagcggaggatgcagagagggcag
gagatgaatgggaggctcagtcagatcgcacagccaggccccagtggacagcagcaacgg
ccttgcacagggactgccaaggaacagcagcttctaccccaggaagccacagctggggac
aaggccagcacgctgagccatctgtaa

DBGET integrated database retrieval system