KEGG   Rattus norvegicus (rat): 171047
Entry
171047            CDS       T01003                                 
Symbol
Dnph1
Name
(RefSeq) 5-hydroxymethyl-dUMP N-hydrolase
  KO
K22928  2'-deoxynucleoside 5'-phosphate N-hydrolase [EC:3.2.2.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    171047 (Dnph1)
SSDB
Motif
Pfam: Nuc_deoxyrib_tr Nuc_deoxyri_tr2
Other DBs
NCBI-GeneID: 171047
NCBI-ProteinID: NP_598209
RGD: 620382
Ensembl: ENSRNOG00000018397
Position
9:complement(21978894..21981631)
AA seq 163 aa
MAASGEQAPCSVYFCGSIRGGREDQALYARIVSRLRRYGKVLTEHVADAELEPLGEEAAG
GDQFIHEQDLNWLQQADVVVAEVTQPSLGVGYELGRAVALGKPILCLFRPQSGRVLSAMI
RGAADGSRFQVWDYAEGEVETMLDRYFEAYLPQKTASSSHPSA
NT seq 492 nt   +upstreamnt  +downstreamnt
atggcggcatccggggagcaggctccatgctccgtgtacttctgcgggagcatccgcggc
gggcgcgaggaccaagcactgtatgcgcggatcgtgtcgcggctgcgacgctatgggaag
gtgctcactgagcacgtggctgatgctgagttggagccgcttggggaagaggctgctggg
ggtgaccagttcatccatgagcaggacctgaactggctgcagcaagcagatgtggtagtg
gcggaagtgacacagccatccttgggtgttggctatgaactgggccgggcagtagctctt
gggaagccaattctgtgcctgtttcgaccacagtctggccgagtgctttccgccatgatc
cgcggagcagcagatggctcgaggttccaggtatgggactacgcagagggagaagtggag
accatgctcgatcggtactttgaggcatatcttcctcagaagacggcttcctccagtcac
ccaagtgcctga

DBGET integrated database retrieval system