KEGG   Rattus norvegicus (rat): 171050Help
Entry
171050            CDS       T01003                                 

Gene name
Mob4, Mobkl1, Mobkl3, Phocn, Prei3, phocein
Definition
(RefSeq) MOB family member 4, phocein
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Mob1_phocein
Motif
Other DBs
NCBI-GeneID: 171050
NCBI-ProteinID: NP_598212
RGD: 620183
Ensembl: ENSRNOG00000014980
UniProt: Q9QYW3
Position
9q31
AA seq 225 aa AA seqDB search
MVMAEGTAVLRRNRPGTKAQDFYNWPDESFDEMDSTLAVQQYIQQNIRADCSNIDKILEP
PEGQDEGVWKYEHLRQFCLELNGLAVKLQSECHPDTCTQMTATEQWIFLCAAHKTPKECP
AIDYTRHTLDGAACLLNSNKYFPSRVSIKESSVAKLGSVCRRIYRIFSHAYFHHRQIFDE
YENETFLCHRFTKFVMKYNLMSKDNLIVPILEEEVQNSVSGESEA
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggtcatggcggaggggacggcagtgctgaggcggaacaggccaggcaccaaggcgcag
gatttctataattggcctgatgaatcatttgatgaaatggacagtacacttgctgttcag
cagtatattcaacagaacataagggcagactgctccaatattgacaaaattcttgaacca
cctgaaggtcaagatgaaggtgtatggaagtatgaacatttaaggcaattctgccttgaa
ctaaatggacttgctgtcaaacttcagagtgagtgccatcctgatacttgtactcagatg
acagcaactgaacaatggatttttctttgtgcagctcataaaactccaaaagagtgtcct
gccatagattatacaagacacacactggatggtgctgcatgtcttctgaatagcaataaa
tattttcccagcagggttagcataaaagaatcatctgtagcaaaactaggatcagtgtgc
cgtaggatttacagaatattctcacatgcctattttcatcaccggcagatatttgatgaa
tatgaaaatgaaacatttttatgtcaccggtttaccaaatttgtgatgaaatataatttg
atgtcgaaggataacctgattgtaccaattttagaagaggaagttcagaattcagtttct
ggggaaagtgaagcatga

DBGET integrated database retrieval system