KEGG   Rattus norvegicus (rat): 171051Help
Entry
171051            CDS       T01003                                 

Gene name
Cabp1
Definition
(RefSeq) calcium binding protein 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 Dockerin_1 SPARC_Ca_bdg TerB DIMCO_N EF-hand_4 POTRA_2
Motif
Other DBs
NCBI-GeneID: 171051
NCBI-ProteinID: NP_001028848
RGD: 620385
Ensembl: ENSRNOG00000001173
UniProt: O88751
Position
12q16
AA seq 350 aa AA seqDB search
MGGGDGAAFKRPGDGARLQRVLGLGSRRAPRSLPSGGPAPPPPGHASAGPAAMSSHIAKS
ESKTSLLKAAAASGGSRAPRHSSARDPGLRGRRLPGPCPDSPATCGDPSSRRPLCRPVPR
DEGARGSRRGLPQAHCRPRETLPPARGRDGEERGLAPALSLRGSLRSRGRGDPAPAGTPE
ADPFLHQLRPMLSSAFGQDRSLRPEEIEELREAFREFDKDKDGYINCRDLGNCMRTMGYM
PTEMELIELSQQINMNLGGHVDFDDFVELMGPKLLAETADMIGVKELRDAFREFDTNGDG
EISTSELREAMRKLLGHQVGHRDIEEIIRDVDLNGDGRVDFEEFVRMMSR
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgggcggcggcgacggggccgcatttaagcggccaggggacggcgcccgcctgcagcgc
gtcctcgggctcggctcccgccgggcgccccgctccctgccctccgggggccccgcgcca
cccccgccgggccatgcgagcgcgggccccgccgcgatgagctcgcacatcgccaagagc
gagtccaagacgtcgctgctcaaggcggcggcggcgagcgggggcagccgggctccccgc
cacagctctgcgcgggaccccgggctgcgtggccgcaggctgcccggtccctgccccgac
tcgcctgcaacgtgcggggaccccagctcgcggaggcccctgtgccggccggtgccgcgg
gacgagggcgcgcgcgggagccggcgtgggctgccccaggcgcactgcaggccccgggag
acgctaccgccggcccgcgggcgcgatggggaggaacgggggctggcgccggctctcagt
ctacggggctccctgcgatcgcggggtcgcggggacccggctcccgctggcacccccgag
gcggacccgttcctccaccagctgcgccccatgctcagctccgccttcggtcaggataga
tcgttacgaccagaggagatcgaagagctccgagaggccttccgggaatttgacaaggac
aaagatggctacatcaactgccgggacctggggaactgcatgcgcaccatgggctacatg
cccactgagatggaactcatcgagctgtcccagcagatcaacatgaacctgggtggccac
gtggatttcgatgactttgtggaactgatgggccctaaactcctggcggagacagcagat
atgatcggtgtaaaggaactgagagacgcctttcgggagtttgacaccaacggtgacggg
gagataagcacgagcgagctgcgagaggccatgaggaagctcctgggtcatcaggtggga
caccgggacatagaggaaattatccgagacgtggacctcaatggagatggacgagtggac
ttcgaagagtttgtccggatgatgtctcgctga

DBGET integrated database retrieval system