KEGG   Rattus norvegicus (rat): 171051
Entry
171051            CDS       T01003                                 

Gene name
Cabp1
Definition
(RefSeq) calcium-binding protein 1 isoform 3
  KO
K23531  calcium-binding protein 1/2/4/5
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    171051 (Cabp1)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    171051 (Cabp1)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    171051 (Cabp1)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 EF-hand domain-containing proteins
  Calcium binding proteins
   171051 (Cabp1)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 Dockerin_1 SPARC_Ca_bdg DIMCO_N EF-hand_4 POTRA_2
Other DBs
NCBI-GeneID: 171051
NCBI-ProteinID: NP_001028848
RGD: 620385
Ensembl: ENSRNOG00000001173
UniProt: O88751
Position
12
AA seq 350 aa
MGGGDGAAFKRPGDGARLQRVLGLGSRRAPRSLPSGGPAPPPPGHASAGPAAMSSHIAKS
ESKTSLLKAAAASGGSRAPRHSSARDPGLRGRRLPGPCPDSPATCGDPSSRRPLCRPVPR
DEGARGSRRGLPQAHCRPRETLPPARGRDGEERGLAPALSLRGSLRSRGRGDPAPAGTPE
ADPFLHQLRPMLSSAFGQDRSLRPEEIEELREAFREFDKDKDGYINCRDLGNCMRTMGYM
PTEMELIELSQQINMNLGGHVDFDDFVELMGPKLLAETADMIGVKELRDAFREFDTNGDG
EISTSELREAMRKLLGHQVGHRDIEEIIRDVDLNGDGRVDFEEFVRMMSR
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgggcggcggcgacggggccgcatttaagcggccaggggacggcgcccgcctgcagcgc
gtcctcgggctcggctcccgccgggcgccccgctccctgccctccgggggccccgcgcca
cccccgccgggccatgcgagcgcgggccccgccgcgatgagctcgcacatcgccaagagc
gagtccaagacgtcgctgctcaaggcggcggcggcgagcgggggcagccgggctccccgc
cacagctctgcgcgggaccccgggctgcgtggccgcaggctgcccggtccctgccccgac
tcgcctgcaacgtgcggggaccccagctcgcggaggcccctgtgccggccggtgccgcgg
gacgagggcgcgcgcgggagccggcgtgggctgccccaggcgcactgcaggccccgggag
acgctaccgccggcccgcgggcgcgatggggaggaacgggggctggcgccggctctcagt
ctacggggctccctgcgatcgcggggtcgcggggacccggctcccgctggcacccccgag
gcggacccgttcctccaccagctgcgccccatgctcagctccgccttcggtcaggataga
tcgttacgaccagaggagatcgaagagctccgagaggccttccgggaatttgacaaggac
aaagatggctacatcaactgccgggacctggggaactgcatgcgcaccatgggctacatg
cccactgagatggaactcatcgagctgtcccagcagatcaacatgaacctgggtggccac
gtggatttcgatgactttgtggaactgatgggccctaaactcctggcggagacagcagat
atgatcggtgtaaaggaactgagagacgcctttcgggagtttgacaccaacggtgacggg
gagataagcacgagcgagctgcgagaggccatgaggaagctcctgggtcatcaggtggga
caccgggacatagaggaaattatccgagacgtggacctcaatggagatggacgagtggac
ttcgaagagtttgtccggatgatgtctcgctga

DBGET integrated database retrieval system