KEGG   Rattus norvegicus (rat): 171054Help
Entry
171054            CDS       T01003                                 

Gene name
Ccr4, Cmkbr4
Definition
(RefSeq) C-C motif chemokine receptor 4
  KO
K04179  C-C chemokine receptor type 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    171054 (Ccr4)
   04061 Viral protein interaction with cytokine and cytokine receptor
    171054 (Ccr4)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    171054 (Ccr4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    171054 (Ccr4)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    171054 (Ccr4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    171054 (Ccr4)
   04050 Cytokine receptors [BR:rno04050]
    171054 (Ccr4)
   04090 CD molecules [BR:rno04090]
    171054 (Ccr4)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    171054 (Ccr4)
Cytokine receptors [BR:rno04050]
 Chemokine receptors
  CC Chemokine
   171054 (Ccr4)
CD molecules [BR:rno04090]
 Proteins
  171054 (Ccr4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 171054
NCBI-ProteinID: NP_598216
RGD: 620594
Ensembl: ENSRNOG00000010315
UniProt: Q91ZH4
Position
8q32
AA seq 360 aa AA seqDB search
MNATDVTDTTQDEAAYNSYYFDESLPKPCTKEGIKAFGEVFLPPLYSLVFLLGLFGNSVV
VLVLFKYKRLKSMTDVYLLNLAISDLLFVLSLPFWGYYAADQWVFGLGLCKIISWMYLVG
FYSGIFFIMLMSIDRYLAIVHAVFSLRARTLTYGVITSLITWSVAVFASLPGLLFSTCDT
ENNHTYCKTQYSVNSTTWKVLSSLEINVLGLVIPLGIMLFCYSMIIRTLRHCKNEKKNRA
VRMIFAVVVLFLGFWTPYNVVLFLETLVELEVLQDCTLERYLDYAIQATETLAFIHCCLN
PVIYFFLGEKFRKYIAQLFRTCRGPPVLCQHCDFLQISSADTSSSSYTQSTVDHDFRDAL
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccacagatgtcacagacaccacccaggatgaagccgcgtacaatagttactac
ttcgacgagagcttgccaaagccttgcaccaaggaaggcatcaaggcgttcggcgaggtc
ttcctgcctcctctctactccttggtctttctgttgggtctgtttgggaattctgttgtg
gttctggtgctgttcaagtacaagaggctcaagtccatgactgacgtgtacctgctgaac
ctagccatctcggatttactgtttgtgctgtctctcccgttctggggctactatgctgct
gaccagtgggtttttggtctaggtctgtgtaagattatctcatggatgtacctggtgggc
ttctacagcgggatcttcttcatcatgctcatgagtatagacagatacctggccatcgtg
cacgcagtgttttccttgagagcgaggactctgacctatggggtcatcaccagcctcatc
acgtggtctgtggctgtgtttgcctccctaccaggcctcttgttcagcacctgcgacaca
gagaacaaccacacatactgcaaaacccagtactcggtcaactcgaccacgtggaaagtc
ctcagctccctggagatcaatgtcttggggctggtcatccccctggggatcatgttgttc
tgctattccatgatcatcaggaccctgagacactgcaagaatgagaagaagaacagagca
gttcggatgatcttcgccgtggtggtcctcttcctcggcttctggacgccgtacaacgtg
gtgcttttcctggagaccttggtggagctcgaagtccttcaggactgcaccttggagagg
tacctagactatgccatccaggccacagaaaccctggccttcattcactgctgccttaac
cctgtcatttacttcttccttggggagaaattccgcaagtacatcgcccaactcttcaga
acgtgccggggtcctcctgtgctctgccaacactgtgacttccttcagatctcctcggcc
gacacttccagctcctcttacactcagtccactgtggatcatgacttccgtgacgctttg
taa

DBGET integrated database retrieval system