KEGG   Rattus norvegicus (rat): 171056Help
Entry
171056            CDS       T01003                                 

Gene name
Cx3cr1, Rbs11
Definition
(RefSeq) C-X3-C motif chemokine receptor 1
  KO
K04192  CX3C chemokine receptor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    171056 (Cx3cr1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    171056 (Cx3cr1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    171056 (Cx3cr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    171056 (Cx3cr1)
   04050 Cytokine receptors [BR:rno04050]
    171056 (Cx3cr1)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Chemokine
   CX3C Chemokine
    171056 (Cx3cr1)
Cytokine receptors [BR:rno04050]
 Chemokine receptors
  CX3C Chemokine
   171056 (Cx3cr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 171056
NCBI-ProteinID: NP_598218
RGD: 620137
Ensembl: ENSRNOG00000018509
UniProt: P35411
Position
8q32
AA seq 354 aa AA seqDB search
MPTSFPELDLENFEYDDSAEACYLGDIVAFGTIFLSIFYSLVFTFGLVGNLLVVLALTNS
RKSKSITDIYLLNLALSDLLFVATLPFWTHYLISHEGLHNAMCKLTTAFFFIGFFGGIFF
ITVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAAAILVASPQFMFTKRKDNECLGDY
PEVLQEIWPVLRNSEVNILGFVLPLLIMSFCYFRIVRTLFSCKNRKKARAIRLILLVVVV
FFLFWTPYNIVIFLETLKFYNFFPSCGMKRDLRWALSVTETVAFSHCCLNPFIYAFAGEK
FRRYLRHLYNKCLAVLCGRPVHAGFSTESQRSRQDSILSSLTHYTSEGEGSLLL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgcctacctccttcccggaattggatctagagaactttgagtatgatgactctgctgag
gcctgttatttgggtgacatcgtggcctttgggaccatcttcctatctattttctactcc
cttgtcttcacgttcggtctggtggggaatctgttggtggtcctcgccctcaccaacagc
cggaagtccaagagcatcactgacatctacctcctgaacctggccttgagcgacctgctc
tttgtggccactttgcccttctggactcactacctcatcagccatgagggcctccacaac
gccatgtgcaagctcacgactgctttcttcttcattggcttctttgggggcatattcttc
atcaccgtcatcagcatcgaccggtacctcgccatcgtcctggccgccaactccatgaac
aaccggacagtgcaacacggcgtcaccatcagtctgggcgtctgggcggcggccatctta
gtggcgtcgccccagttcatgttcacaaagagaaaggacaacgaatgtttgggtgattac
cccgaggtcctgcaggaaatctggcccgtgctccgcaactcggaggtcaacatcctgggc
ttcgtcctgcccttgcttatcatgagcttttgctacttccgcatcgtccggacgctgttt
tcctgcaagaaccggaagaaggccagagccattaggctcatcctcttggtggttgttgtc
ttcttcctcttctggacgccttacaacatcgtgattttcctggagactctcaaattctac
aacttcttccctagttgtggcatgaagagggacctgaggtgggcccttagtgtgacggag
acagtggcgtttagccactgctgcctcaacccctttatctacgctttcgctggggaaaag
ttcagaaggtacctgagacacctgtacaacaagtgcctggccgtcctgtgcggtcgtcct
gtccacgccggcttctcaacagagtcccagaggagcaggcaggacagcattctgagcagc
ttgactcactacacaagcgagggagagggatctctcctgctctga

DBGET integrated database retrieval system