KEGG   Rattus norvegicus (rat): 171062
Entry
171062            CDS       T01003                                 

Gene name
Nkg7
Definition
(RefSeq) natural killer cell granule protein 7
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Claudin_3 GSG-1
Other DBs
NCBI-GeneID: 171062
NCBI-ProteinID: NP_598224
RGD: 621523
Ensembl: ENSRNOG00000017749
UniProt: Q9WVL9
Position
1q22
AA seq 165 aa
MEPYRSLALLAGCLGLIFSLIALSTDFWIVATGPNFSAHSGLWPTSPGTQVAGYIHVTQV
CCILAALWGLVSVSFLVLSCIPSLSAPGRGPMVSTVLSFAAALSIIVAMAVYTSERWSQP
PSPQVQTFFSWSFYLGWGSAIPFLCAGCLSLGAHCRTRRTEYETL
NT seq 498 nt   +upstreamnt  +downstreamnt
atggagccctaccggtccctggccctgcttgctggctgtctgggcctgattttttcactg
attgctctgagcactgacttctggatagtggccaccggccccaacttctctgcccactct
ggcctctggccaacaagcccagggactcaagtagcaggttatatccacgtgacacaggtc
tgctgtatcctggctgccctgtggggcctggtatccgtgagcttcctggttctgtcttgt
atcccatccctgtctgctcctggccgtggccctatggtctcaactgtcttgtcttttgct
gcagctctctccatcatagtggccatggcagtgtacaccagcgagagatggagccagcct
ccatctccccaggtccagacattcttctcctggtccttctacctaggctggggctccgcc
atccctttcctctgtgcaggctgcctgagcctgggtgctcactgtagaacccgtcggact
gagtacgaaaccttgtga

DBGET integrated database retrieval system