KEGG   Rattus norvegicus (rat): 171068
Entry
171068            CDS       T01003                                 

Gene name
Pou2f1
Definition
(RefSeq) POU class 2 homeobox 1
  KO
K09364  POU domain transcription factor, class 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    171068 (Pou2f1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    171068 (Pou2f1)
   03021 Transcription machinery [BR:rno03021]
    171068 (Pou2f1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   POU domain factors
    171068 (Pou2f1)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase III system
   Other transcription-related factors
    Octamer transcription factors
     171068 (Pou2f1)
SSDB
Motif
Pfam: Pou Homeodomain HTH_31 Homeobox_KN
Other DBs
NCBI-GeneID: 171068
NCBI-ProteinID: NP_001094109
RGD: 621689
Ensembl: ENSRNOG00000003581
UniProt: P31503 F1LRD7
Position
13q23
AA seq 768 aa
MADGGAASQDESSAAAAAAADSRMNNPSETNKSSMESGDASTGTQTNGLDFEKQPVPVGG
AISTAQAQAFLGHLHQVQLAGTSLQAAAQSLNVQSKSSEESGDSQQSSQPSQQPSVQSAI
PQTQLMLAGGQITGLTLTPAQQQLLLQQAQAQAQLLAAAVQQHSASQQHSAAGATISASA
ATPMTQIPLSQPIQIAQDLQQLQQLQQQNLNLQQFVLVHPTTNLQPAQFIISQTPQGQQG
LLQAQNLLTQLPQQSQANLLQPQPSITLTSQPTTPTRTIAATPIQTLPQSQTTPKRIDTP
SLEEPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFK
NMCKLKPLLEKWLNDAENLSSDSTASSPSALNSPGLGAEGLNRRRKKRTSIETNIRVALE
KSFMENQKPTSEDITLIAEQLNMEKEVIRVWFCNRRQKEKRINPPSSGGTSSSPIKAIFP
SPTSLVATTPSLVTSSTATTLTVNPVLPLTSAAMTNLSLTGTTDSTSNNTATVISTAPPA
SSAVTSPSLSPSPSASASTSEASSASETSTTQTTSTPLPSPLGASQVMVTASGLQTAAAA
ALQGAAQLPANASLAAMAAAAGLNPGLMAPSQFAAGGALLSLNPGTLGGALSPALMSNST
LATIQALASSGSLPITSLDATGNLVFANAGGAPNIVTAPLFLNPQNLSLLTSNPVSLVSA
AAASTGNSAPTASLHASSTSTESIQNSLFTVASASGAASTTTAASKAQ
NT seq 2307 nt   +upstreamnt  +downstreamnt
atggcggacggaggagcagcgagtcaagatgagagttcagccgcggcggcagcagcagca
gactcaagaatgaacaatccgtcagaaaccaataagtcatctatggagagtggagatgcc
agcacaggcacacagaccaatggcctggactttgagaagcagcccgtgcctgtcggaggg
gccatctccacagcccaggcccaggctttccttgggcatcttcaccaggtccagctcgct
gggacaagtttacaggctgctgctcaatctttaaatgtacagtctaaatctagtgaagag
tccggagattcgcagcagtcaagccagccttcccagcagccttcagtgcagtcagccatt
ccccagactcagctaatgctggccgggggacagataactgggctcacactgacaccagcc
cagcaacagcttttactacagcaggcccaggcccaggcccagctcctggctgctgcagtg
cagcaacactccgccagccaacagcacagtgctgctggggccaccatctcagcctccgct
gccacacccatgacgcagatccccctgtctcagcccatacagattgcacaggatcttcaa
caattgcaacagcttcagcagcaaaatctcaacttgcaacagttcgtcttggtgcaccca
accaccaacttgcaaccagcacagtttatcatctctcagaccccccagggccagcagggt
ctcctgcaagcgcaaaatcttttaacgcaactacctcagcaaagccaagccaacctccta
cagccacagccaagcatcaccctcacgtcccagcctaccaccccaactcgcacaatagca
gcaaccccaattcagacacttccacagagccagacaacaccaaagcgaattgatactccc
agcttggaggagcccagtgaccttgaggagcttgagcaatttgccaagacttttaaacaa
agacgaatcaaacttggattcactcagggtgatgttgggcttgctatggggaaattatat
ggaaatgacttcagccaaaccaccatctctcgctttgaagccttgaacctcagctttaag
aacatgtgcaagttaaagccccttttagagaagtggctaaatgacgcggagaacctctca
tctgattctacagcatctagcccaagtgctttgaattctccagggttgggggctgagggc
ttgaatcgtaggaggaaaaaacgcaccagcatagagaccaacatccgtgtggccttagaa
aagagtttcatggagaatcaaaagcctacctcggaagatatcaccttgattgctgaacag
ctcaatatggagaaggaggtgattcgtgtttggttttgtaaccgccgccagaaggagaaa
agaatcaacccgccaagcagtggtgggaccagcagctcaccaatcaaagcaattttcccc
agcccaacctcactggtggcaaccactccaagccttgtgacaagcagtacagcaactacc
ctcacagtcaaccctgtgctccccttaaccagtgctgccatgactaatctttctcttaca
ggcactacagactccacgtccaacaacacggccaccgtgatttccacagcaccccctgct
tcctcagcagtcacatctccctccttgagtccctctccttctgcctcagcctccacctct
gaggcctctagtgccagcgagaccagcacaacacagaccacctccacacctctcccctcc
cctcttggagccagccaggtgatggtgacagcctctggcttacagactgcagccgccgct
gctctccaaggagctgcacagttgccagcaaatgccagtcttgctgctatggctgctgct
gcaggactcaatccaggcctgatggcaccctcacagtttgctgctggaggtgccttactc
agtctcaatccggggaccctgggtggggctctcagcccggccctgatgagcaacagtaca
ctggcaaccattcaagctcttgcttctagtggctctcttccaataacatctctggatgca
actgggaacctggtattcgccaatgcaggaggagcccccaacatcgtgactgcccctctg
ttcctgaaccctcagaacctctctctgctcaccagcaacccagtaagcttggtttctgcc
gctgcagcctccacagggaactccgcacctacagccagccttcatgcctcctccacctca
actgagtccatccagaactctctgttcacagtggcctctgccagcggggctgcctccacc
accacagctgcctccaaggcacagtga

DBGET integrated database retrieval system