KEGG   Rattus norvegicus (rat): 171080Help
Entry
171080            CDS       T01003                                 

Gene name
Slc17a1, Napi-1
Definition
(RefSeq) solute carrier family 17 member 1
  KO
K12300  MFS transporter, ACS family, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 1/2/3/4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    171080 (Slc17a1)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC17: Vesicular glutamate transporter
   171080 (Slc17a1)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Anion:cation symporter (ACS) family [TC:2.A.1.14]
    171080 (Slc17a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MFS_1
Motif
Other DBs
NCBI-GeneID: 171080
NCBI-ProteinID: NP_598238
RGD: 620099
UniProt: Q6AZ46
Position
17p11
AA seq 465 aa AA seqDB search
MENRCLPKKVPGFCSFRYGLAILLHFCNIVIMAQRVCLNLTMVAMVNKTEPPHLSNKSVA
EMLDNVKNPVHSWSLDIQGLILSSVFLGMVVIQVPVGYLSGAYPMKKIIGSSLFLSSVLS
LLIPPAAQVGAALVIVCRVLQGIAQGAVSTGQHGIWVKWAPPLERGRLTSMTLSGFVMGP
FIALLVSGFICDLLGWPMVFYIFGIVGCVLSLFWFILFFDDPNNHPYMSSSEKDYITSSL
MQQVHSGRQSLPIKAMLKSLPLWAIILNSFAFIWSNNLLVTYTPTFISTTLHVNVRENGL
LSSLPYLLAYICGIVAGQMSDFLLSRKIFSVVAVRKLFTTLGIFCPVIFVVCLLYLSYNF
YSTVIFLTLANSTLSFSFCGQLINALDIAPRYYGFLKAVTALIGIFGGLISSTLAGLILN
QDPEYAWHKNFFLMAGINVTCLAFYLLFAKGDIQDWAKETKTTRL
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggagaaccggtgcctccccaagaaagttccaggtttctgttcctttcggtatggactg
gctatccttttgcacttctgtaacattgtcatcatggctcagcgagtgtgcctgaacctc
acaatggtagccatggtgaataaaacagagccaccccatttatctaacaagtctgtagca
gagatgctggataatgtaaagaaccctgtgcattcctggagtcttgatattcaagggctt
attctcagttctgtcttcttgggtatggttgtgattcaagttcctgttgggtacctatct
ggagcatacccaatgaagaaaataattgggtcttcattgttcctcagctctgtgctgtcc
ctgctcatcccaccagctgcacaagtcggagcagctttggtcattgtatgccgagtactc
caaggaatagcccagggagcagtgtcaacaggccagcatggaatatgggtcaaatgggca
cctcccttggaacgaggcagacttacctctatgactctatcagggtttgtaatgggacca
tttattgccctgcttgtgagtggcttcatctgtgatcttctgggttggcccatggttttc
tacatctttggtattgttgggtgtgttctgagtcttttctggttcatccttttctttgat
gaccccaacaaccacccatatatgagcagcagtgagaaggattacatcacatcctctctc
atgcaacaggtgcactcgggcagacaatctctgccaatcaaagctatgcttaagtctctt
ccactctgggccattatcctcaatagctttgctttcatatggtcgaacaatcttctggtt
acatacacgccaacatttattagcaccacgcttcatgttaatgttagagagaatgggctg
ctgtccagcctcccctatctgcttgcctacatctgtggtatcgtagcaggtcagatgtca
gacttcctcctgtcaaggaagattttcagcgtagttgctgtccggaaactcttcaccaca
ctagggattttctgtcctgtgatttttgtcgtgtgcctgctctacctgagctacaacttc
tacagcaccgtcattttccttacacttgccaactcgacacttagcttttccttctgtgga
caacttatcaatgccttggatattgctcccagatattatggatttctaaaggcagtcaca
gctttaattggaatatttgggggcctaatttcttcaactcttgctgggttgatccttaat
caggatccagaatatgcttggcataaaaacttcttcttgatggcaggcattaacgtgaca
tgcctggctttctaccttctgtttgcaaaaggagatattcaggactgggctaaagaaaca
aaaaccacacggctgtga

DBGET integrated database retrieval system