KEGG   Rattus norvegicus (rat): 171082Help
Entry
171082            CDS       T01003                                 

Gene name
Atp5g2
Definition
(RefSeq) ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C2 (subunit 9)
  KO
K02128  F-type H+-transporting ATPase subunit c
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05016  Huntington disease
Module
rno_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    171082 (Atp5g2)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    171082 (Atp5g2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    171082 (Atp5g2)
   05012 Parkinson disease
    171082 (Atp5g2)
   05016 Huntington disease
    171082 (Atp5g2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-synt_C
Motif
Other DBs
NCBI-GeneID: 171082
NCBI-ProteinID: NP_598240
RGD: 620051
Ensembl: ENSRNOG00000015320
UniProt: Q06646
Position
7q36
AA seq 141 aa AA seqDB search
MYACSKFVSTRSLIRSTSQLLSRPLSAVELKRPQMPTDEGLSCLAVRRPLTSLIPSRSFQ
TSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGF
ALSEAMGLFCLMVAFLILFAM
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgtatgcctgctccaagttcgtctctacccgctccctgatcaggagcacctctcagctg
ctgagccgtccgctctctgcagtggagttaaagcgaccacagatgcccacagatgagggc
ctcagctgcttggcagtccggcggcctctgacctcgcttatccctagccgcagcttccaa
accagcgccatttcaagggacattgacacagctgccaagttcattggagctggggctgct
acagttggggtggccggttctggagcaggaattgggactgtttttgggagtctcatcatt
ggctatgccaggaacccctctctgaagcagcaactcttctcctatgcgattctgggcttc
gccctctctgaggccatggggctcttttgcctaatggtggccttcctcatcctcttcgcc
atgtga

DBGET integrated database retrieval system