KEGG   Rattus norvegicus (rat): 171084
Entry
171084            CDS       T01003                                 

Gene name
Nat8b, Cml1, Cml6, Nat8, RGD621605
Definition
(RefSeq) N-acetyltransferase 8B
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 Acetyltransf_CG Acetyltransf_9 Acetyltransf_3 FR47 Acetyltransf_4 DUF5493 Acetyltransf_8 Acetyltransf_15 DUF4131
Other DBs
NCBI-GeneID: 171084
NCBI-ProteinID: NP_598242
RGD: 621605
Ensembl: ENSRNOG00000015851
UniProt: Q9JIY6
Position
4q34
AA seq 222 aa
MVSYHICEYQDSDYKSVVDVFTKGAEEYIPSTFRHLLLLPRTLLLLLGVSLALVLVSGSW
LLAVVCIFFLLPFLWFLAGQPWKNYVSKCLHTDMADITKSYLSDRGSGFWVAESGEQVVG
TVGALPVKEPPSGRKQLQLFHLAVSSQHRGQGIAKALVRTVLQFARDQGYTDVVLETSTM
QIGAVTLYLGMGFQKTGQYFPSMLWRLVGIRFVQLNYSFPSA
NT seq 669 nt   +upstreamnt  +downstreamnt
atggtttcttatcacatctgcgagtaccaagacagcgactataaaagtgttgtggatgtg
tttaccaagggtgcagaagagtacatcccctccaccttccgccacttgctgctgctgccc
cgaaccctcctactcttacttggggtgtcccttgccctggtcctggtgtctggctcctgg
ctgctggctgttgtatgcatcttttttctgctcccatttttgtggttccttgctggacag
ccctggaagaattatgtgtccaaatgtttacacacagatatggctgacatcaccaagtct
tatctgagtgatcgtggctcaggtttctgggtggctgagtctggggagcaggtagtgggc
acagtgggtgctctgccagtcaaggagcctccatcagggaggaagcagttgcagctcttc
cacctggctgtgtcctcacagcatcgaggacaggggatagcgaaagcactggtcagaact
gtgctccagtttgcacgggaccagggctacactgatgttgtccttgagactagcaccatg
cagataggtgctgtgaccctctacctgggcatgggtttccagaagacaggccaatacttc
ccgagtatgctctggaggttagtgggtattcgttttgttcaactaaattactccttccct
tctgcctag

DBGET integrated database retrieval system