KEGG   Rattus norvegicus (rat): 171086Help
Entry
171086            CDS       T01003                                 

Gene name
Trak2, Als2cr3, GRIF-1
Definition
(RefSeq) trafficking kinesin protein 2
  KO
K15374  trafficking kinesin-binding protein 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01100  Metabolic pathways
rno04727  GABAergic synapse
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    171086 (Trak2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAP1_N Milton
Motif
Other DBs
NCBI-GeneID: 171086
NCBI-ProteinID: NP_598244
RGD: 620915
Ensembl: ENSRNOG00000010881
UniProt: Q8R2H7
Position
9q31
AA seq 913 aa AA seqDB search
MSLSQNAIFKSQTGEENLMSSNHRDSESITDVCSNEDLPEVELVNLLEEQLPQYKLRVDS
LFLYENQDWSQSSHQQQDASETLSPVLAEETFRYMILGTDRVEQMTKTYNDIDMVTHLLA
ERDRDLELAARIGQALLKRNHVLSEQNESLEEQLGQAFDQVNQLQHELSKKEELLRIVSI
ASEESETDSSCSTPLRFNESFSLSQGLLQLDMMHEKLKELEEENMALRSKACHIKTETFT
YEEKEQKLINDCVNELRETNAQMSRMTEELSGKSDELLRYQEEISSLLSQIVDLQHKLKE
HVIEKEELRLHLQASKDAQRQLTMELHELQDRNMECLGMLHESQEEIKELRNKAGPSAHL
CFSQAYGVFAGESLAAEIEGTMRKKLSLDEESVFKQKAQQKRVFDTVKVANDTRGRSVTF
PVLLPIPGSNRSSVIMTAKPFESGVQQTEDKTLPNQGSSTEVPGNSHPRDPPGLPEDSDL
ATALHRLSLRRQNYLSEKQFFAEEWERKLQILAEQEEEVSSCEALTENLASFCTDQSETT
ELGSAGCLRGFMPEKLQIVKPLEGSQTLHHWQQLAQPNLGTILDPRPGVITKGFTQMPKD
AVYHISDLEEDEEVGITFQVQQPLQLEQKPAPPPPVTGIFLPPMTSAGGPVSVATSNPGK
CLSFTNSTFTFTTCRILHPSDITQVTPSSGFPSLSCGSSAGSASNTAVNSPAASYRLSIG
ESITNRRDSTITFSSTRSLAKLLQERGISAKVYHSPASENPLLQLRPKALATPSTPPNSP
SQSPCSSPVPFEPRVHVSENFLASRPAETFLQEMYGLRPSRAPPDVGQLKMNLVDRLKRL
GIARVVKTPVPRENGKSREAEMGLQKPDSAVYLNSGGSLLGGLRRNQSLPVMMGSFGAPV
CTTSPKMGILKED
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgtcccagaatgccattttcaagtcacaaacaggtgaagaaaacctcatgagt
agcaaccatagagactcggagagcatcactgatgtctgctccaatgaggatctccctgag
gtcgagctggtcaacttgctggaagagcagctgccacagtataagctaagagtggactct
ctctttctctacgaaaaccaagactggtcccagtcatcacaccagcagcaggatgcatct
gagaccctctctccagtcctggctgaggagaccttccgctacatgattctaggcacagac
agagtagagcagatgaccaaaacctacaatgacattgacatggtcacgcatctcctggca
gagagggaccgagatctagagctggctgctcggattgggcaagccctgctaaagcggaac
catgtcttatctgagcagaatgaatctctggaggagcagctgggacaagcctttgatcaa
gtcaatcagctgcagcacgagctgtccaagaaagaggagctgctccgaatcgtctccatc
gcctcagaggagagtgagacggattccagctgttccacacccctccggttcaatgagtcc
ttcagcttatctcaaggcctgctgcagctggacatgatgcacgagaagctcaaggagctg
gaagaagagaacatggcccttcggtccaaggcttgtcacatcaagacagaaacatttacc
tatgaagagaaggaacaaaagctcatcaatgactgtgttaatgaactccgtgagaccaat
gcacagatgtccagaatgactgaagagctgtcgggaaagagcgatgagctgcttcggtac
caagaagagatctcttccctgctgtctcagatcgtagaccttcagcacaaactgaaagaa
catgtgatcgagaaggaagaactgagacttcacctgcaggcgtccaaagatgcccagcga
cagctgacgatggagcttcacgagttacaggacagaaacatggagtgcctgggaatgtta
catgagtctcaagaagaaataaaagagcttcggaacaaagccggcccttccgctcatctc
tgcttctcccaggcttacggggtttttgcaggggagtcactggcagctgagattgaaggg
accatgcgtaaaaagctgagtttggatgaggaatctgtctttaaacaaaaggcccagcaa
aaacgggtgtttgatactgtcaaggttgccaacgacacacggggccgctctgtcacattc
ccagtcctgctgcccatcccaggctccaaccgttcaagtgtcatcatgacagcaaagccc
tttgagtccggtgttcagcaaacagaggacaaaacactcccgaaccaagggagcagcaca
gaggttccagggaactctcatcccagggaccccccaggactccctgaagatagtgacctg
gctacagcattgcatcgccttagcctgagaagacagaactacctaagtgagaagcagttc
ttcgctgaagaatgggaacggaagctccagattctggctgagcaggaggaagaagttagc
agctgtgaggccctcacggagaaccttgcctcattctgcactgaccagtcagagaccacg
gagctcggcagtgccggctgccttcgaggcttcatgccagaaaagttacagattgtcaag
cccctagaaggatcacagacgctacatcattggcagcagcttgctcaaccaaacttggga
accatccttgatccacgcccaggcgtcatcactaaaggcttcacgcagatgcccaaggat
gccgtctatcacatctcggatttggaggaggatgaagaagtggggatcacttttcaggtt
cagcagcctcttcaactggagcagaagcctgcaccacccccgccagtaacgggtatcttc
ctgccgcccatgacctcagcagggggaccagtctcagttgcaacttcgaacccaggaaag
tgtctctcattcacgaactcaacattcaccttcaccacctgcaggatcttacacccctct
gacatcactcaggtcacccctagctctggtttcccatcactgtcctgtggaagcagtgcg
ggcagtgcatccaacacggctgtgaactctcctgctgcgtcctacagactgagcattggt
gaatccatcacaaaccggcgcgactccaccataacgttcagtagcacgaggagcttagcc
aaactcctgcaggagcgaggcatctccgccaaagtgtaccacagcccagcttcagaaaac
ccccttctacagcttcgccccaaggccctggccaccccttccacaccaccaaattccccg
tcgcagtcaccatgttcctcccccgtgccctttgaaccccgtgtccatgtctccgagaat
ttcttggcttccagaccagctgaaacattcctgcaagaaatgtatggcttgagaccttca
agggcccctcctgatgttggccagctgaagatgaacttggtggacaggctgaagaggctg
ggaatagccagggtggtcaagacccctgttccccgggagaatgggaaaagccgagaggca
gaaatgggtcttcaaaaaccagactctgctgtctatttaaattctggtggcagtttattg
ggtggactgaggaggaatcagagtctcccagtcatgatgggtagctttggagccccagtt
tgcacaacctcgcccaaaatgggtatcctgaaggaagactga

DBGET integrated database retrieval system