KEGG   Rattus norvegicus (rat): 171087
Entry
171087            CDS       T01003                                 

Gene name
Mpc1, Brp44l
Definition
(RefSeq) mitochondrial pyruvate carrier 1
  KO
K22138  mitochondrial pyruvate carrier 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    171087 (Mpc1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    171087 (Mpc1)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial protein import machinery
  Inner mambrane
   Other inner membrane factors
    171087 (Mpc1)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC54: Mitochondrial pyruvate carrier
   171087 (Mpc1)
SSDB
Motif
Pfam: MPC
Other DBs
NCBI-GeneID: 171087
NCBI-ProteinID: NP_598245
RGD: 620902
Ensembl: ENSRNOG00000012415
UniProt: P63031
Position
1q12
AA seq 109 aa
MAGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGRMTFALC
CYSLTFMRFAYKVQPRNWLLFACHVTNEVAQLIQGGRLINYEMSKRPSA
NT seq 330 nt   +upstreamnt  +downstreamnt
atggctggagctctggtgcgcaaagcagcggactatgtccggagcaaggacttccgggac
tatctcatgagtacgcacttctggggcccagttgccaactggggtctccccattgctgct
atcaatgacatgaagaaatctccagagattatcagtgggcggatgactttcgccctctgt
tgctattctctgacattcatgagatttgcctacaaggtacaaccccgaaactggcttctg
tttgcgtgccatgtgacaaacgaagtcgctcagctcattcagggaggacgacttatcaac
tacgagatgagtaagcggccatctgcctag

DBGET integrated database retrieval system