KEGG   Rattus norvegicus (rat): 171096Help
Entry
171096            CDS       T01003                                 

Gene name
Cst6
Definition
(RefSeq) cystatin E/M
  KO
K13902  cystatin-M
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    171096 (Cst6)
Peptidases and inhibitors [BR:rno01002]
 Peptidase inhibitors
  Family I25: cystatin family
   171096 (Cst6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cystatin SQAPI OstA_2
Motif
Other DBs
NCBI-GeneID: 171096
NCBI-ProteinID: NP_598250
RGD: 628799
Ensembl: ENSRNOG00000020455
UniProt: Q8VHC1
Position
1q43
AA seq 149 aa AA seqDB search
MERPHFPLAMGLGLLAFCLLTLSPDARAELRSRRTGERQNLSPDDPRVLKAAQAAVASYN
MDSNSLYYFRDTKVIDAKCQLVAGIKYYMTVDIESTECRKTRVSGDHVDLTTCPLAAGVQ
QEKLRCNFELLEVPWKNTTQLLKHDCVQV
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atggagcgtcctcacttcccgctggcgatgggccttggcctgctcgcattctgcctcctg
accctatccccggatgcccgcgctgagctgcggagccgcaggaccggagaacgccagaac
ctgtcacccgacgacccgcgggtgctgaaggccgcacaggcagctgtggccagctacaat
atggacagcaacagcctctactacttccgagacaccaaagtcatcgatgcaaaatgtcag
ctggtggctggcatcaagtactacatgactgtggacatagaaagcaccgagtgcagaaag
accagagtctctggagaccacgtggacctcaccacctgccccctggctgcaggagtgcaa
caggagaaacttcgttgcaacttcgagctccttgaagtcccttggaagaacaccactcag
cttctaaagcatgactgcgtgcaggtgtga

DBGET integrated database retrieval system