KEGG   Rattus norvegicus (rat): 171104
Entry
171104            CDS       T01003                                 

Gene name
Gper1
Definition
(RefSeq) G-protein coupled estrogen receptor 1
  KO
K04246  G-protein coupled estrogen receptor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04915  Estrogen signaling pathway
rno04929  GnRH secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    171104 (Gper1)
   04915 Estrogen signaling pathway
    171104 (Gper1)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    171104 (Gper1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    171104 (Gper1)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Others
   Estrogen
    171104 (Gper1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 171104
NCBI-ProteinID: NP_598257
RGD: 619845
Ensembl: ENSRNOG00000001287
UniProt: O08878
Position
12
AA seq 375 aa
MAATTPAQDVGVEIYLGPVWPAPSNSTPLALNLSLALREDAPGNLTGDLSEHQQYVIALF
LSCLYTIFLFPIGFVGNILILVVNISFREKMTIPDLYFINLAAADLILVADSLIEVFNLD
EQYYDIAVLCTFMSLFLQINMYSSVFFLTWMSFDRYLALAKAMRCGLFRTKHHARLSCGL
IWMASVSATLVPFTAVHLRHTEEACFCFADVREVQWLEVTLGFIVPFAIIGLCYSLIVRA
LIRAHRHRGLRPRRQKALRMIFAVVLVFFICWLPENVFISVHLLQWAQPGDTPCKQSFRH
AYPLTGHIVNLAAFSNSCLNPLIYSFLGETFRDKLRLYVAQKTSLPALNRFCHATLKAVI
PDSTEQSDVKFSSAV
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggctgcaactactccagcacaagatgttggcgtagagatctacctaggtcccgtgtgg
ccagccccttccaacagcacccctctggccctcaacctgtccctggcgctgcgggaagat
gccccggggaacctcactggggacctctctgaacatcagcaatatgtgatcgctctcttc
ctctcctgcctctacaccatcttcctcttccccatcggctttgtgggcaacatcctcatc
ttggtggtgaacatcagcttccgggagaagatgactatcccagacctgtacttcatcaac
ctggcagcggccgacctcatcctggtggccgactccctgatcgaggtgttcaacctggac
gagcagtactacgatatcgccgtgctctgcaccttcatgtccctcttcctgcagatcaac
atgtacagcagcgtcttcttcctcacctggatgagcttcgacaggtacctggcgctggcc
aaagccatgcgctgtggcctcttccgcaccaagcaccacgcgcggctcagctgtggcctc
atctggatggcctcagtgtccgccacgctggtgcccttcacggccgtgcatctgcggcac
accgaggaggcctgcttctgctttgccgatgtcagggaggtgcagtggctggaggtcacg
ctgggcttcattgtgcccttcgccatcatcggcctgtgctattccctcatcgtgcgggcc
ctcatccgggcccacaggcatcgtggcctgcgcccacgcaggcagaaagccctgaggatg
atcttcgcagtggtccttgtcttcttcatctgctggctgccggagaacgtcttcatcagc
gtccacctactgcagtgggcgcagccaggggacactccctgcaagcagtctttccgtcat
gcctaccccttgacaggccacatagtcaacctggcagccttctccaacagctgcctgaat
cccctcatctatagcttcctgggagagaccttcagggacaagctcaggctgtatgtggcg
cagaagacgagcctgccagctctcaaccgcttctgccatgccacgctcaaggcagtcata
ccagacagcacggagcagtcagatgtcaagttcagcagtgctgtatga

DBGET integrated database retrieval system