KEGG   Rattus norvegicus (rat): 171106
Entry
171106            CDS       T01003                                 

Gene name
Il1rl2
Definition
(RefSeq) interleukin-1 receptor-like 2 precursor
  KO
K05172  interleukin 1 receptor-like 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    171106 (Il1rl2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rno04050]
    171106 (Il1rl2)
Cytokine receptors [BR:rno04050]
 Interleukin receptor families
  IL1 receptor family
   171106 (Il1rl2)
SSDB
Motif
Pfam: TIR Ig_2 Ig_3 Ig_6 I-set ig Ig_4 TIR_2
Other DBs
NCBI-GeneID: 171106
NCBI-ProteinID: NP_598259
RGD: 621782
Ensembl: ENSRNOG00000014683
UniProt: Q62929
Position
9
AA seq 561 aa
MGMPPLLFCWVSFVLPLFVAAGNCTDVYMHHEMISEGQPFPFNCTYPPVTNGAVNLTWHR
TPSKSPISINRHVRIHQDQSWILFLPLALEDSGIYQCVIKDAHSCYRIAINLTVFRKHWC
DSSNEESSINSSDEYQQWLPIGKSGSLTCHLYFPESCVLDSIKWYKGCEEIKVSKKFCPT
GTKLLVNNIDVEDSGSYACSARLTHLGRIFTVRNYIAVNTKEVGSGGRIPNITYPKNNSI
EVQLGSTLIVDCNITDTKENTNLRCWRVNNTLVDDYYNDSKRIQEGIETNLSLRNHILYT
VNITFLEVKMEDYGHPFTCHAGVSAAYIILKRPAPDFRAYLIGGLMAFLLLAVSILYIYN
TFKVDIVLWYRSTFHTAQAPDDEKLYDAYVLYPKYPRESQGHDVDTLVLKILPEVLEKQC
GYKLFIFGRDEFPGQAVASVIDENIKLCRRLMVLVAPETSSFSFLKNLTEEQIAVYNALV
QDGMKVILIELERVKDYSTMPESIQYIRQKHGAIQWDGDFTEQAQCAKTKFWKKVRYHMP
PRRYPASPPVQLLGHTPRIPG
NT seq 1686 nt   +upstreamnt  +downstreamnt
atggggatgccacccttgctcttctgttgggtgtctttcgtgcttccactttttgtggca
gcaggtaactgtactgatgtctatatgcaccatgagatgatttcagagggccagcctttc
cccttcaactgcacataccctccagtaacaaacggggcagtgaatctgacatggcataga
acacccagtaagagcccaatctccatcaacagacacgttagaattcaccaggaccagtcc
tggattttgtttcttccgttggcattggaggactcaggcatctatcaatgtgttataaag
gatgcccacagctgttaccgaatagctataaacctaaccgtttttagaaaacactggtgc
gactcttccaacgaagagagttccataaattcctcagatgagtaccagcaatggttaccc
ataggaaaatcgggcagtctgacgtgccatctctacttcccagagagctgtgttttggat
tcaataaagtggtataagggttgtgaagagattaaagtgagcaagaagttttgccctaca
ggaacaaagcttcttgttaacaacatcgacgtggaggatagtgggagctatgcatgctca
gccagactgacacacttggggagaatcttcacggttagaaactacattgctgtgaatacc
aaggaagttgggtctggaggaaggatccctaacatcacgtatccaaaaaacaactccatt
gaagttcaacttggctccaccctcattgtggactgcaatataacagacacgaaggagaat
acgaacctcagatgctggcgagttaacaacaccctggtggacgattactacaacgactcc
aaacgcatccaggaaggaatcgaaaccaatctgtctctgaggaatcacattctgtacaca
gtgaacataacattcttagaagtgaaaatggaggactacggccatcctttcacatgccac
gctggcgtgtccgcagcctacatcattctgaaacgcccagctccagacttccgggcttac
ctcataggaggtctcatggctttcctacttctggccgtgtccattctgtacatctacaac
acctttaaggtcgacatcgtgctttggtataggagtaccttccacactgcccaggctcca
gatgacgagaagctgtatgatgcctatgtcttataccccaagtacccaagagaaagccag
ggccatgatgtggacacactggtgttgaagatcttgcccgaggtgctggagaaacagtgt
ggatataagttattcatatttggcagggatgaattccctggacaagctgtggccagcgtc
attgatgaaaacattaagctgtgtaggaggctgatggtcctcgtggcaccagagacatcc
agcttcagctttctgaagaacttgactgaagaacaaatcgctgtctacaatgccctcgtc
caggacggcatgaaggtcattctgattgaactggagagagtcaaggactacagcaccatg
cccgagtccattcagtacatccgacagaagcacggggccatccagtgggatggggacttc
acagagcaggcacagtgcgccaagacgaaattctggaagaaagtgagatatcatatgcca
cccaggaggtacccggcatctccccccgtccagctgctaggacacacaccccgcatacca
ggctag

DBGET integrated database retrieval system