KEGG   Rattus norvegicus (rat): 171108Help
Entry
171108            CDS       T01003                                 

Gene name
P2ry14, Gpr105
Definition
(RefSeq) purinergic receptor P2Y14
  KO
K04299  P2Y purinoceptor 14
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    171108 (P2ry14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    171108 (P2ry14)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Base and nucleoside
   Purine / pyrimidine
    171108 (P2ry14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 171108
NCBI-ProteinID: NP_598261
RGD: 70912
Ensembl: ENSRNOG00000013872
Vega: OTTRNOG00000001296
UniProt: O35881
Position
2q26
AA seq 305 aa AA seqDB search
MDNTTTTEPPKQPCTRNTLITQQIIPMLYCVVFITGVLLNGISGWIFFYVPSSKSFIIYL
KNIVVADFLMGLTFPFKVLSDSGLGPWQLNVFVFRVSAVIFYVNMYVSIAFFGLISFDRY
YKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPNIILTNQSVKDVTNIQCMELKNELG
RKWHKASNYVFVSIFWIVFLLLTVFYMAITRKIFKSHLKSRKNSISVKRKSSRNIFSIVL
AFVACFAPYHVARIPYTKSQTEGHYSCQAKETLLYTKEFTLLLSAANVCLDPISISSYAS
RLEKS
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggacaacacaacaaccacagaacctccaaagcagccctgcacccggaacaccctgatc
acacagcagatcatccccatgttgtactgtgtggtcttcatcacaggggtcctcctcaac
ggaatatcgggatggatattcttttacgtgcccagctctaagagttttatcatctatctc
aagaacatagttgtggctgactttctcatgggcctcactttccctttcaaagtcctcagc
gactcaggcctcggtccctggcagctgaatgtgtttgtattcagggtgtctgccgtgatc
ttctacgtcaacatgtacgtcagcatcgcgttcttcgggctcatcagctttgacaggtac
tataaaatcgtgaagccccttctggtgtctatcgtccagtcagtgaactacagcaaagtg
ctgtccgtgcttgtgtgggtgctcatgcttctcctcgctgtccccaacatcattctgaca
aaccagagtgtcaaggatgtcactaacatacagtgcatggaactcaaaaacgagctgggg
cggaagtggcacaaggcgtctaactatgtcttcgtgagcattttctggatcgtgttcctt
ctgctgaccgtcttctacatggccataacgaggaagatcttcaagtctcacctcaagtcc
agaaagaattccatctccgtcaaaaggaagtccagccgcaatatattcagcattgtgctc
gcatttgtcgcctgtttcgcgccttaccacgttgccaggatcccctacaccaagagccag
acggaaggacactacagctgccaggccaaggagaccctgctctatacgaaagaattcacc
ctgctgctctcggctgccaatgtgtgtctggaccccatatctatttcttcttatgccagc
cgtttagagaagtcttga

DBGET integrated database retrieval system