KEGG   Rattus norvegicus (rat): 171112Help
Entry
171112            CDS       T01003                                 

Gene name
Wfdc1, ps20
Definition
(RefSeq) WAP four-disulfide core domain 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: WAP
Motif
Other DBs
NCBI-GeneID: 171112
NCBI-ProteinID: NP_598265
RGD: 68938
Ensembl: ENSRNOG00000015904
UniProt: O70280
Position
19q12
AA seq 212 aa AA seqDB search
MGSCDRKALWALSFLLLLLGSSSVQGTWEAMLPVRLAEKSQAEEVAATGSRQPHADRCPP
PPRTLPPGACQATRCQSDSECPRHRRCCYNGCAYACLEAVPPPPVLDWLVQPKPRWLGGN
GWLLDGPEEVLQAEACSTTEDGAEPLLCPSGYECHILQPGDAAQGIPNHGRCVKQRRQAE
GRVLRQKLHKEYPEGDSKYVAEPGKGQQRHFP
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgggtagctgcgacaggaaagccctctgggctctgagcttcctactgctgctactgggc
tccagctctgttcagggcacttgggaggcaatgttgccggtcaggctggctgagaagtcc
caagctgaagaggttgcagcaacaggctcccggcagccccacgcagaccgctgcccacca
ccgccacggacgctacccccgggtgcctgtcaggccacacgctgccagtctgactctgag
tgcccacgacacagacgctgctgttacaacggctgtgcctatgcctgcctggaggcggtg
ccaccgccaccagttctagactggctggtgcagcccaaaccacggtggcttggtggcaat
ggctggctgctggatggtccggaggaagtgttacaagcagaggcctgcagcaccactgag
gatggggcagagccactcctctgtccctcaggctatgagtgccacatcctgcagccaggg
gatgcggcccagggcatacccaaccatggacggtgtgttaagcaacgtcgacaagcagag
gggcgggtcctgcgacagaagcttcacaaggagtacccagaaggtgactccaagtatgtg
gcagagcctgggaagggacaacagaggcactttccatga

DBGET integrated database retrieval system