KEGG   Rattus norvegicus (rat): 171116
Entry
171116            CDS       T01003                                 

Gene name
Opa1
Definition
(RefSeq) OPA1, mitochondrial dynamin like GTPase
  KO
K17079  optic atrophy protein 1 [EC:3.6.5.5]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05017  Spinocerebellar ataxia
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    171116 (Opa1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.5  dynamin GTPase
     171116 (Opa1)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    171116 (Opa1)
SSDB
Motif
Pfam: Dynamin_N MMR_HSR1 FeoB_N DUF1593 Roc DUF2267 AAA_16 KxDL
Other DBs
NCBI-GeneID: 171116
NCBI-ProteinID: NP_598269
RGD: 708423
Ensembl: ENSRNOG00000001717
UniProt: Q2TA68
Position
11q22
AA seq 960 aa
MWRAGRAALACEVCQSLVKHSSGVQRNVPLQKLHLVSRSIYRSHHPALKLQRPQLRTSFQ
QFSSLTNLSLHKLKLSPTKYGYQPRRNFWPARLAARLLKLRYIILGSAVGGGYTAKKTFD
EWKDMIPDLSDYKWIVPDFIWEIDEYIDLEKIRKALPSSEDLANFAPDLDKIAESLSLLK
DFFTAGTPGETAFRATDHGSESDKHYRKVSDKEKIDQLQEELLHTQLKYQRILERLEKEN
KELRKLVLQKDDKGIHHRKLKKSLIDMYSEVLDVLSDYDASYNTQDHLPRVVVVGDQSAG
KTSVLEMIAQARIFPRGSGEMMTRSPVKVTLSEGPHHVALFKDSSREFDLTKEEDLAALR
HEIELRMRKNVKEGCTVSPETISLNVKGPGLQRMVLVDLPGVINTVTSGMAPDTKETIFS
ISKAYMQNPNAIILCIQDGSVDAERSIVTDLVSQMDPHGRRTIFVLTKVDLAEKNVASPS
RIQQIIEGKLFPMKALGYFAVVTGKGNSSESIEAIREYEEEFFQNSKLLKTSMLKAHQVT
TRNLSLAVSDCFWKMVRESVEQQADSFKATRFNLETEWKNNYPRLRELDRNELFEKAKNE
ILDEVISLSQVTPKHWEEILQQSLWERVSTHVIENIYLPAAQTMNSGTFNTTVDIKLKQW
TDKQLPNKAVEVAWETLQDEFSRFMTEPKGKEHDDIFDKLKEAVKEESIKRHKWNDFAED
SLRVIQHNALEDRSISDKQQWDAAIYFMEEALQGRLKDTENAIENMIGPDWKKRWIYWKN
RTQEQCVHNETKNELEKMLKVNDEHPAYLASDEITTVRKNLESRGVEVDPSLIKDTWHQV
YRRHFLKTALNHCNLCRRGFYYYQRHFIDSELECNDVVLFWRIQRMLAITANTLRQQLTN
TEVRRLEKNVKEVLEDFAEDGEKKVKLLTGKRVQLAEDLKKVREIQEKLDAFIEALHQEK
NT seq 2883 nt   +upstreamnt  +downstreamnt
atgtggcgagcaggtcgggctgccctggcctgtgaagtctgccaatccttagtgaagcac
agctctggagtacaaagaaacgtaccgctccaaaaactgcatctggtttcccgaagtatt
tatcgttcacatcatcctgccctcaagcttcaaagaccccaattaaggacatcttttcag
caattctcttctctaactaacctttctttacataaattgaaactttctccaactaaatat
ggctaccaaccccgcaggaacttttggccagcaaggttagctgcaaggctcttaaaactt
cgatatattatactgggatctgctgttggaggtggctatacagccaaaaaaaccttcgat
gaatggaaagatatgataccagaccttagtgactataagtggattgtgcctgactttata
tgggaaattgatgagtatattgatttggagaaaatcagaaaagcccttcccagttcagaa
gacctcgccaatttcgctcctgacctggacaagatcgccgaaagcctcagcttgttgaag
gatttcttcactgcgggtacacctggagaaacagcatttagagcaacagatcatggatcc
gaaagtgacaagcactataggaaggtgtcagacaaagaaaagattgaccaacttcaggaa
gaacttctgcatactcagttaaagtatcagaggatcctggagcgtttggagaaggagaac
aaagagttgaggaagttggtgctgcagaaggatgacaaaggcatccaccacaggaagctc
aagaaatctctgatcgatatgtattctgaagttcttgatgtcctttctgactatgatgcc
agctacaatacccaagatcatctgccacgggttgttgtggttggagatcagagtgctgga
aaaacaagtgttctggaaatgattgctcaagcacgaatattcccacgaggatccggtgag
atgatgacgcgctctccagtgaaggtgactctcagtgaaggccctcaccacgtggccttg
tttaaagacagctcccgggagtttgacctcaccaaggaggaagatcttgcagcgttaaga
catgaaattgaactccggatgagaaaaaatgtgaaagaaggttgtactgttagccctgag
accatatctttaaatgtcaaaggccctgggctgcagaggatggtgctggtggacttgcct
ggtgttatcaacactgtgacatcaggcatggctcccgacacaaaggaaactattttcagt
atcagcaaagcttacatgcagaatcctaacgccatcatcctgtgcattcaagatggatct
gtagatgccgagcgcagtattgttacagacttggtcagtcaaatggatccgcatggaaga
agaaccatatttgttttgaccaaagtagacctggcagaaaaaaatgtagccagtccaagc
agaatacaacagataattgaaggcaagctcttcccaatgaaagctctgggttattttgct
gtcgtaacaggaaaaggaaacagctctgaaagcattgaagctataagagaatatgaagag
gaattttttcagaattcaaaactgctaaagacaagcatgctaaaggcacaccaggtgacc
acgagaaatctaagccttgccgtgtcagactgcttttggaaaatggttcgagagtcggtt
gaacaacaggctgatagttttaaagcgactcgcttcaacctggagacagagtggaagaac
aactacccccgcctgcgggagctcgacaggaatgaactatttgaaaaggctaaaaatgag
atcctcgatgaagtcatcagtctgagccaggttactccaaagcactgggaggagatcctt
cagcagtccctgtgggaacgagtgtcaacgcatgtgatcgagaacatctacctcccagct
gcccagaccatgaactcaggaacattcaacaccacagtggacatcaagcttaaacagtgg
actgacaagcagcttcctaataaagcagtcgaggttgcttgggagaccctacaagacgaa
ttttcccgcttcatgacagaacccaaaggaaaggaacacgatgacatatttgacaaactt
aaggaggctgtgaaggaggagagtatcaagcggcacaaatggaacgacttcgcagaagac
agcttgagggtcatccagcacaacgctctggaggaccggtccatatcagataagcaacag
tgggacgcagccatctacttcatggaagaggcacttcaaggtcgtctcaaggatactgaa
aatgctattgaaaacatgatcgggccagactggaaaaagaggtggatatactggaagaat
cggacccaagagcagtgtgttcacaatgaaaccaagaatgaattggaaaagatgctgaag
gttaatgatgaacacccagcttatcttgcaagtgatgagattaccacagtccggaagaac
ctggaatctcgaggagtcgaagtcgatccaagcctgattaaggatacttggcatcaagtc
tatagaagacatttcctaaaaacagctctaaatcactgtaacctttgtcggagaggtttt
tattactaccagaggcattttatagactctgagctggagtgcaacgacgtggtcctgttc
tggcgaatacagcgcatgctcgctatcactgccaacacgctgaggcagcagctgacaaac
accgaagttaggcggctagagaaaaacgttaaagaggtattagaagattttgctgaagac
ggcgagaagaaggttaaattgcttactggcaaacgagttcagctggcagaagatctcaag
aaagttagagaaattcaagaaaaacttgatgctttcattgaagctcttcaccaggagaag
tag

DBGET integrated database retrieval system