KEGG   Rattus norvegicus (rat): 171126
Entry
171126            CDS       T01003                                 

Gene name
Ap3m1, P47a
Definition
(RefSeq) adaptor-related protein complex 3, mu 1 subunit
  KO
K12398  AP-3 complex subunit mu
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    171126 (Ap3m1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    171126 (Ap3m1)
Membrane trafficking [BR:rno04131]
 Endosome - Lysosome transport
  Others
   AP-3 complex
    171126 (Ap3m1)
 Endosome - Golgi transport
    171126 (Ap3m1)
SSDB
Motif
Pfam: Adap_comp_sub Clat_adaptor_s
Other DBs
NCBI-GeneID: 171126
NCBI-ProteinID: NP_598277
RGD: 620417
Ensembl: ENSRNOG00000011461
UniProt: Q6IRG9
Structure
PDB: 
4IKN

Position
15p16
AA seq 418 aa
MIHSLFLINCSGDIFLEKHWKSVVSQSVCDYFFEAQEKAADVENVPPVISTPHHYLISIY
RDKLFFVSVIQTEVPPLFVIEFLHRVADTFQDYFGECSEAAIKDNVVIVYELLEEMLDNG
FPLATESNILKELIKPPTILRSVVNSITGSSNVGDTLPTGQLSNIPWRRAGVKYTNNEAY
FDVVEEIDAIIDKSGSTVFAEIQGVIDACIKLSGMPDLSLSFMNPRLLDDVSFHPCIRFK
RWESERVLSFIPPDGNFRLISYRVSSQNLVAIPVYVKHNISFKENSSCGRFDITIGPKQN
MGKTIEGITVTVHMPKVVLNMNLTPTQGSYTFDPVTKVLAWDVGKITPQKLPSLKGLVNL
QSGAPKPEENPNLNIQFKIQQLAISGLKVNRLDMYGEKYKPFKGVKYITKAGKFQVRT
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgatccacagtctatttctcatcaactgttctggcgacatatttctagaaaaacactgg
aagagcgttgtaagccaatctgtgtgtgactatttctttgaagctcaggagaaagctgct
gatgttgaaaatgtaccacctgtcatttcaacacctcaccactacctcattagtatctac
cgggataagctcttctttgtgtctgtgatacagactgaagtgccacctctctttgtaatt
gagtttctgcatcgagttgctgacacttttcaggactactttggtgagtgttcagaggct
gcaattaaggataatgtggtcatagtgtatgagctcttggaagaaatgttagacaatgga
ttcccactggctaccgaatctaacattctgaaagaactgattaaaccaccaacaattcta
cgttctgtcgtcaattctattacaggcagtagtaatgttggggacacgctccccactggg
cagctgtccaacatcccgtggcgtcgagcaggtgtaaagtacaccaacaatgaagcctac
tttgatgtagtcgaagagatagatgcgattatagataaatcaggatctacagtctttgca
gaaattcaaggtgtcattgatgcttgcattaagctgtctggaatgcctgatctctctctc
tctttcatgaacccaaggcttctagatgatgtcagcttccacccatgcatccggttcaaa
cgctgggaatctgagagagttttgtcattcattcctcccgatggaaatttccgactcata
tcataccgcgtcagctcacaaaatctagtggcaatcccagtgtatgtgaaacataatatc
agctttaaggaaaacagctcttgtggtagatttgatataacaattggaccaaaacagaat
atgggaaaaacgattgaaggaatcacagtgactgttcacatgccaaaagttgtgctgaat
atgaacctgacaccaacacaaggcagctatacattcgatccagtcaccaaggtactagca
tgggatgtggggaaaattactccacaaaagctcccaagtcttaaaggactggtaaattta
cagtcaggagcacccaagccagaagagaacccaaacctcaacatacagttcaagatccag
cagcttgctatttcaggcttaaaagtgaaccgcttggacatgtatggtgagaagtataag
ccatttaaaggagtcaagtatatcacaaaggccggaaagttccaagtgaggacatga

DBGET integrated database retrieval system