KEGG   Rattus norvegicus (rat): 171131
Entry
171131            CDS       T01003                                 

Gene name
Chrnb3
Definition
(RefSeq) cholinergic receptor nicotinic beta 3 subunit
  KO
K04814  nicotinic acetylcholine receptor beta-3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    171131 (Chrnb3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    171131 (Chrnb3)
Ion channels [BR:rno04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   171131 (Chrnb3)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 171131
NCBI-ProteinID: NP_598281
RGD: 621544
Ensembl: ENSRNOG00000012448
Vega: OTTRNOG00000002140
UniProt: P12391
Position
16q12.3
AA seq 464 aa
MTGFLRVFLVLSATLSGSWVTLTATAGLSSVAEHEDALLRHLFQGYQKWVRPVLNSSDII
KVYFGLKISQLVDVDEKNQLMTTNVWLKQEWTDQKLRWNPEEYGGINSIKVPSESLWLPD
IVLFENADGRFEGSLMTKAIVKSSGTVSWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSW
TYDGTMVDLILINENVDRKDFFDNGEWEILNAKGMKGNRREGFYSYPFVTYSFVLRRLPL
FYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIP
LIGEYLLFIMIFVTLSIIVTVFVINVHHRSSSTYHPMAPWVKRLFLQRLPRWLCMKDPMD
RFSFPDGKESDTAVRGKVSGKRKQTPASDGERVLVAFLEKASESIRYISRHVKKEHFISQ
VVQDWKFVAQVLDRIFLWLFLIASVLGSILIFIPALKMWIHRFH
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgacaggcttcctaagggtcttcttggttctcagtgccactctctcaggttcctgggtg
actcttacggccactgcaggactcagctcagtggctgaacacgaagacgcactcctcaga
catttgttccaaggttaccagaaatgggtccgccctgtgttgaattccagtgacatcata
aaagtgtattttggattaaaaatatcccagcttgtggatgtggatgaaaagaatcagctg
atgacgacaaatgtgtggctgaagcaggaatggacagaccaaaaattacgctggaatccg
gaagaatatggtggaattaattcgataaaggttccatcagaatcgctctggctgccggac
atagttctctttgaaaatgctgacggacgttttgagggctccctcatgaccaaggccatt
gtgaagtccagtggaaccgtcagctggactcctcccgccagctacaagagttcctgcacc
atggatgtcacatttttcccgttcgacaggcagaactgctcgatgaagtttggatcctgg
acttacgacggtaccatggttgacctcattctaatcaatgaaaacgttgaccggaaagac
ttttttgataacggagagtgggagatactcaacgcaaaggggatgaagggcaacagaaga
gaaggcttttactcctatccgtttgttacctactcttttgtcctgagacgcctgcccttg
ttttacacgctctttttgataatcccctgcctggggttgtcttttctcacggtcctggtg
ttctacctaccctcggacgaaggggaaaaactctcattatccacctccgttttggtctct
ttgacggtgtttcttttagtgattgaagaaataatcccgtcctcttcgaaggtcatcccc
ctcattggcgagtacctcctcttcattatgatttttgtcacgctgtctattatcgtcacg
gtttttgtaattaatgtccaccacagatcttcctcaacgtaccatcccatggccccctgg
gtgaagaggctgtttctacaaagactcccgagatggctttgcatgaaggaccccatggac
cgcttctctttcccggatggaaaggagagtgatacagccgtgagggggaaagtctcaggc
aaaaggaaacagactcccgccagcgatggagaaagagttctggtcgctttcctcgagaag
gcctccgagtccatcagatacatttcgaggcatgtgaaaaaggaacacttcatcagccag
gtagtgcaagactggaaatttgtggctcaagttctggaccgcatcttcctgtggctcttt
ctgatagcttctgtgttgggttccattctgatttttattccagccttgaagatgtggata
catcgtttccactag

DBGET integrated database retrieval system