KEGG   Rattus norvegicus (rat): 171133
Entry
171133            CDS       T01003                                 

Gene name
Gcsh
Definition
(RefSeq) glycine cleavage system protein H
  KO
K02437  glycine cleavage system H protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00260  Glycine, serine and threonine metabolism
rno00630  Glyoxylate and dicarboxylate metabolism
rno01100  Metabolic pathways
rno01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    171133 (Gcsh)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    171133 (Gcsh)
SSDB
Motif
Pfam: GCV_H
Other DBs
NCBI-GeneID: 171133
NCBI-ProteinID: NP_598282
RGD: 619946
Ensembl: ENSRNOG00000011535
UniProt: Q5I0P2
Position
19q12
AA seq 170 aa
MSLRVVRSVRAVACSLRIALASCPPRPWAPSAAAVRSLRTGSALLSVRKFTEKHEWVTAK
DGIGTVGISNFAQEALGDVVYCSLPEVGTKLKKQEEFGALESVKAASELYSPLSGEVTEV
NEALAENPGLVNKSCYEDGWLIKMTLSDPSELDELMSEEAYEKYVKSIEE
NT seq 513 nt   +upstreamnt  +downstreamnt
atgtcgctgcgagtggtaaggagtgtgcgggctgtggcctgcagcctgcgcatcgccctg
gcctcctgcccgccaaggccctgggcgccgagcgctgccgctgtccgctcgctgcgcacc
ggatctgctttgctctcggtgcgtaaattcacagagaagcacgaatgggtaacagcaaag
gatggtattggaacagtgggaatcagcaactttgcacaggaagctttgggagatgttgtt
tactgcagtctgcctgaagttgggacaaaactgaaaaaacaagaggagtttggtgctttg
gaaagcgtgaaggctgccagtgaactctactctcctctgtcaggagaagtaactgaagtc
aatgaagcacttgccgaaaacccagggcttgtcaacaaatcatgttacgaagacggttgg
ctgatcaagatgacactgagtgacccttctgagctggatgaattaatgagtgaagaagcg
tatgagaaatatgtgaagtccattgaggagtga

DBGET integrated database retrieval system