KEGG   Rattus norvegicus (rat): 171135
Entry
171135            CDS       T01003                                 

Gene name
Slc31a1, Ctr1, LRRGT00200
Definition
(RefSeq) solute carrier family 31 member 1
  KO
K14686  solute carrier family 31 (copper transporter), member 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01524  Platinum drug resistance
rno04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    171135 (Slc31a1)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    171135 (Slc31a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    171135 (Slc31a1)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC31: Copper transporter
   171135 (Slc31a1)
SSDB
Motif
Pfam: Ctr
Other DBs
NCBI-GeneID: 171135
NCBI-ProteinID: NP_598284
RGD: 620059
Ensembl: ENSRNOG00000014475
UniProt: Q9JK41
Position
5q24
AA seq 187 aa
MRMNHMEMHHMGMNHTDDNITMPPHQHPTTSASHSHEMMMPMTFYFGFKNVDLLFSSLVI
NTPGEMAGAFVAVFLLAMFYEGLKIAREGLLRKSQVSIRYNSMPVPGPNGTILMETHKTV
GQQMLSFPHLLQTVLHIIQVVISYFLMLIFMTYNGYLCIAVAAGAGTGYFLFSWKKAVVV
DITEHCH
NT seq 564 nt   +upstreamnt  +downstreamnt
atgaggatgaaccacatggagatgcatcatatggggatgaaccacacggacgacaacatc
accatgccaccccaccagcaccccaccacctcggcctcacactcccacgagatgatgatg
cctatgaccttctactttggctttaagaatgtggacctattgttttccagtttggtaatc
aacacacctggagaaatggctggagcttttgtggcagtgtttttactagcaatgttttat
gaaggactcaagatagcccgagagggtctgcttcgaaagtctcaagtcagcattcgctac
aattccatgcctgtgccaggaccaaatggaaccatccttatggagacacacaaaactgtt
gggcagcagatgctgagcttcccccacctcctgcagacagtgctgcacatcatccaagta
gtcatcagctacttcctcatgctcatcttcatgacctacaatgggtacctatgcattgca
gtagccgcaggggctgggacaggatactttctcttcagctggaagaaggctgtggtggtg
gacatcacagagcactgccattaa

DBGET integrated database retrieval system