KEGG   Rattus norvegicus (rat): 171136Help
Entry
171136            CDS       T01003                                 

Gene name
Cblb
Definition
(RefSeq) Cbl proto-oncogene B
  KO
K22517  E3 ubiquitin-protein ligase CBL-B [EC:2.3.2.27]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04012  ErbB signaling pathway
rno04120  Ubiquitin mediated proteolysis
rno04144  Endocytosis
rno04625  C-type lectin receptor signaling pathway
rno04660  T cell receptor signaling pathway
rno04910  Insulin signaling pathway
rno05162  Measles
Brite
KEGG Orthology (KO) [BR:rno00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    171136 (Cblb)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    171136 (Cblb)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    171136 (Cblb)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    171136 (Cblb)
   04660 T cell receptor signaling pathway
    171136 (Cblb)
  Endocrine system
   04910 Insulin signaling pathway
    171136 (Cblb)
 Human Diseases
  Infectious diseases
   05162 Measles
    171136 (Cblb)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     171136 (Cblb)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    171136 (Cblb)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   CBL proteins
    171136 (Cblb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cbl_N Cbl_N3 Cbl_N2 Prok-RING_4 zf-C3HC4_3 zf-C3HC4 zf-RING_2 zf-C3HC4_2 zf-RING_UBOX zf-RING_5 zf-C3HC4_4 zf-rbx1 zf-RING_4
Motif
Other DBs
NCBI-GeneID: 171136
NCBI-ProteinID: NP_598285
RGD: 620535
Ensembl: ENSRNOG00000001982
UniProt: Q8K4S7
Position
11q21
AA seq 938 aa AA seqDB search
MANSMNGRNPGGRGGNPRKGRILGIIDAIQDAVGPPKQAAADRRTVEKTWKLMDKVVRLC
QNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKKSKR
AIRLFKEGKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRITKADAAE
FWRKFFGDKTIVPWKVFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLF
QPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSCTRLGQWAIGYV
TGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQY
ELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEP
IIVDPFDPRDEGSRCCSIIDPFSIPMLDLDDDDDREESLMMNRLASVRKCTDRQNSPVTS
PGSSPLAQRRKPQPDPLQIPHLSLPPVPPRLDLIQKGIVRSPCGSPTGSPKSSPCMVRKQ
DKPLPAPPPPLRDPPPPPERPPPIPPDSRLSRHFHHGESVPSRDQPMPLEAWCPRDAFGT
NQVMGCRILGDGSPKPGVTANSNLNGRHSRMGSDQVLMRKHRRHDLPSEGAKVFSNGHLA
PEEYDVPPRLSPPPPVTALLPSIKCTGPIANCLSEKTRDTVEEDDDEYKIPSSHPVSLNS
QPSHCHNVKPPVRSCDNGHCILNGTHGTPSEMKKSNIPDLGIYLKGEDAFDALPPSLPPP
PPPARHSLIEHSKPPGSSSRPSSGQDLFLLPSDPFFDPASGQVPLPPARRAPGDGVKSNR
ASQDYDQLPSSSDGSQAPARPPKPRPRRTAPEIHHRKPHGPEAALENVDAKIAKLMGEGY
AFEEVKRALEIAQNNLEVARSILREFAFPPPVSPRLNL
NT seq 2817 nt NT seq  +upstreamnt  +downstreamnt
atggcaaattctatgaatggcagaaatcctggtggtcgaggaggaaacccccgcaaaggt
cgaattttggggattattgatgccattcaggatgcagttggacccccaaagcaagctgca
gctgaccgcaggacagtggagaagacttggaaactcatggacaaagtggtaagactgtgc
caaaatccgaaacttcagttgaaaaacagcccaccatatatcctcgacattttacctgat
acgtatcagcatttgcggcttatattgagtaagtatgacgacaaccagaagctggctcaa
ctgagcgagaatgagtactttaaaatctacatcgacagtctcatgaagaagtcaaagcga
gcgatccggctcttcaaagaaggcaaggagaggatgtacgaggagcagtcgcaggacaga
cggaatctcacaaagctgtcccttatcttcagtcacatgctggcagaaatcaaggcgatc
tttcccaatggccagttccagggagataacttccggatcaccaaagcagatgctgccgaa
ttctggaggaagttttttggagacaaaactatcgtaccatggaaagtcttcagacagtgc
ctgcatgaggtccatcagatcagctctggcctggaggccatggctctgaagtcaaccatt
gacttaacttgtaatgattacatctccgtgtttgaatttgatatttttaccaggctattt
cagccctggggctctattttacggaattggaacttcttagctgtgacacacccggggtac
atggcatttctcacatatgatgaagttaaagctcgactacagaaatacagcaccaagcct
ggaagctacattttccggttaagctgcactcggctgggacaatgggccattggctatgtg
actggggacggcaatatcctacagaccatacctcataacaagcccctgttccaagccctg
attgatggtagcagggaaggcttttacctttatccagatggacgaagctataaccctgat
ttaaccggattatgtgaacctacacctcatgatcatataaaagttacacaggagcaatat
gaactgtattgtgaaatgggctccacttttcagctgtgcaagatctgtgcagagaatgac
aaagatgtcaagatcgagccttgtgggcatctcatgtgcacttcgtgccttaccgcgtgg
caggagtctgatggccaaggctgccccttctgtcgctgtgagataaaaggaaccgaacct
atcatcgtggatccctttgaccccagagacgaaggctccaggtgctgcagcatcatcgac
cctttcagcatccccatgctcgacttggatgatgacgatgatcgagaggagtctctgatg
atgaaccggctggcgagtgttcgcaagtgcacagacaggcagaactcgccagtcacatcg
ccaggatcctcaccccttgcccagagaagaaagcctcagccagaccctctccagatcccc
cacctcagcctgccaccagtgcctccccgcctggacctcattcagaaaggcatcgtgcgc
tctccctgtggcagccccacgggctccccgaagtcttctccatgcatggttagaaaacaa
gacaaaccactcccagcaccccctcctcccttgcgagatcctccgcctccaccagagcgg
cctccgccaatcccgcctgacagtagactgagcagacacttccaccacggagagagtgtg
ccttccagggaccagccaatgcctcttgaagcctggtgccctcgggatgccttcgggact
aatcaggtgatgggatgtcgcatcctaggggatggctctccaaagcctggcgtcacagca
aactccaacttaaatggacgtcacagtcgaatgggctctgaccaggttcttatgaggaaa
cacagacgccacgatttgccttcagaaggcgccaaggtcttttccaatggacaccttgcc
cctgaagaatacgacgttcctcctcggctttcccctcctcctccagtcactgcccttctc
cctagcataaagtgtactggtccaatagcaaattgtctctccgagaaaacaagagacaca
gtagaagaagatgatgatgaatacaagattccttcatcccatcctgtttccctgaattca
caaccatctcattgtcataatgtcaaacctcctgttcggtcttgtgataatggtcactgt
atactgaatggaactcatggtacgccttcagagatgaagaaatcaaacatcccagattta
ggcatctatttgaagggtgaagatgcttttgatgccctccccccatcccttcctcctccc
ccacctcctgcaagacatagtctcatcgagcattcaaaacctccaggctccagtagccgg
ccttcctcaggacaggaccttttccttcttccttcagatcccttttttgacccagcaagt
ggccaagttccattgcctccggccaggagagcaccaggagatggtgtcaaatccaacaga
gcctcccaggactatgaccagctcccttcatcttccgatggttcgcaagcaccagctaga
ccccccaaaccacgaccccgaaggactgcaccagaaattcatcacagaaagccccatggg
cccgaggcggcactggaaaatgtggatgcgaaaattgcaaaactcatgggagaggggtat
gcctttgaagaggtgaagagagccttagagatcgcccagaataacctggaagtggccagg
agcatacttcgagaattcgccttccctcctcccgtctcgccacgtctcaatctatag

DBGET integrated database retrieval system