KEGG   Rattus norvegicus (rat): 171138Help
Entry
171138            CDS       T01003                                 

Gene name
Kcne2, Mirp1
Definition
(RefSeq) potassium voltage-gated channel subfamily E regulatory subunit 2
  KO
K04896  potassium voltage-gated channel Isk-related subfamily E member 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    171138 (Kcne2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    171138 (Kcne2)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   171138 (Kcne2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ISK_Channel TMEM154 MacB_PCD Tetraspanin Serine_rich
Motif
Other DBs
NCBI-GeneID: 171138
NCBI-ProteinID: NP_598287
RGD: 621383
Ensembl: ENSRNOG00000029811
UniProt: P63161
Position
11q11
AA seq 123 aa AA seqDB search
MTTLANLTQTLEDAFKKVFITYMDSWRRNTTAEQQALQARVDAENFYYVILYLMVMIGMF
AFIVVAILVSTVKSKRREHSQDPYHQYIVEDWQQKYRSQILHLEDSKATIHENLGATGFT
VSP
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgaccactttagccaacttgacgcagaccctggaggatgccttcaaaaaggttttcatt
acttatatggacagctggaggaggaacacaacagccgaacaacaggcgctccaggccaga
gtggatgccgagaacttctactacgtcatcctgtacctcatggtgatgatcggcatgttc
gccttcatcgtggtggccatcctggtgagcacggtgaagtcgaagcggcgggagcactcc
caggacccgtaccaccagtacatcgtggaggattggcagcagaagtataggagtcagatc
ttgcatctggaagactccaaggccaccatccatgagaacctgggggcgacggggttcaca
gtgtcaccctga

DBGET integrated database retrieval system