KEGG   Rattus norvegicus (rat): 171140
Entry
171140            CDS       T01003                                 

Gene name
Camk2g
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit gamma
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04012  ErbB signaling pathway
rno04020  Calcium signaling pathway
rno04024  cAMP signaling pathway
rno04066  HIF-1 signaling pathway
rno04114  Oocyte meiosis
rno04217  Necroptosis
rno04261  Adrenergic signaling in cardiomyocytes
rno04310  Wnt signaling pathway
rno04360  Axon guidance
rno04713  Circadian entrainment
rno04720  Long-term potentiation
rno04722  Neurotrophin signaling pathway
rno04725  Cholinergic synapse
rno04728  Dopaminergic synapse
rno04740  Olfactory transduction
rno04750  Inflammatory mediator regulation of TRP channels
rno04911  Insulin secretion
rno04912  GnRH signaling pathway
rno04916  Melanogenesis
rno04921  Oxytocin signaling pathway
rno04922  Glucagon signaling pathway
rno04925  Aldosterone synthesis and secretion
rno04934  Cushing syndrome
rno04971  Gastric acid secretion
rno05012  Parkinson disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05031  Amphetamine addiction
rno05152  Tuberculosis
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05214  Glioma
rno05415  Diabetic cardiomyopathy
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    171140 (Camk2g)
   04310 Wnt signaling pathway
    171140 (Camk2g)
   04066 HIF-1 signaling pathway
    171140 (Camk2g)
   04020 Calcium signaling pathway
    171140 (Camk2g)
   04024 cAMP signaling pathway
    171140 (Camk2g)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    171140 (Camk2g)
   04217 Necroptosis
    171140 (Camk2g)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    171140 (Camk2g)
   04922 Glucagon signaling pathway
    171140 (Camk2g)
   04912 GnRH signaling pathway
    171140 (Camk2g)
   04921 Oxytocin signaling pathway
    171140 (Camk2g)
   04916 Melanogenesis
    171140 (Camk2g)
   04925 Aldosterone synthesis and secretion
    171140 (Camk2g)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    171140 (Camk2g)
  09154 Digestive system
   04971 Gastric acid secretion
    171140 (Camk2g)
  09156 Nervous system
   04725 Cholinergic synapse
    171140 (Camk2g)
   04728 Dopaminergic synapse
    171140 (Camk2g)
   04720 Long-term potentiation
    171140 (Camk2g)
   04722 Neurotrophin signaling pathway
    171140 (Camk2g)
  09157 Sensory system
   04740 Olfactory transduction
    171140 (Camk2g)
   04750 Inflammatory mediator regulation of TRP channels
    171140 (Camk2g)
  09158 Development and regeneration
   04360 Axon guidance
    171140 (Camk2g)
  09159 Environmental adaptation
   04713 Circadian entrainment
    171140 (Camk2g)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    171140 (Camk2g)
   05205 Proteoglycans in cancer
    171140 (Camk2g)
  09162 Cancer: specific types
   05214 Glioma
    171140 (Camk2g)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    171140 (Camk2g)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    171140 (Camk2g)
   05022 Pathways of neurodegeneration - multiple diseases
    171140 (Camk2g)
  09165 Substance dependence
   05031 Amphetamine addiction
    171140 (Camk2g)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    171140 (Camk2g)
   05415 Diabetic cardiomyopathy
    171140 (Camk2g)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    171140 (Camk2g)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    171140 (Camk2g)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     171140 (Camk2g)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   171140 (Camk2g)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr DUF4440 SnoaL_3 APH Pkinase_fungal Kdo SnoaL_2 ABC1 RIO1
Other DBs
NCBI-GeneID: 171140
NCBI-ProteinID: NP_598289
RGD: 621802
Ensembl: ENSRNOG00000009783
UniProt: P11730
Position
15
AA seq 527 aa
MATTATCTRFTDDYQLFEELGKGAFSVVRRCVKKTSTQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQI
LESVNHIHQHDIVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITADQALKHPWVCQRSTVASMMHRQETVECLRKFNARRKL
KGAILTTMLVSRNFSVGRQSSAPASPAASAAGLAGQAAKSLLNKKSDGGVKKRKSSSSVH
LMEPQTTVVHNATDGIKGSTESCNTTTEDEDLKVRKQEIIKITEQLIEAINNGDFEAYTK
ICDPGLTSFEPEALGNLVEGMDFHKFYFENLLSKNSKPIHTTILNPHVHVIGEDAACIAY
IRLTQYIDGQGRPRTSQSEETRVWHRRDGKWLNVHYHCSGAPAAPLQ
NT seq 1584 nt   +upstreamnt  +downstreamnt
atggccaccaccgccacctgcacccgcttcaccgacgactaccagcttttcgaggagctc
ggcaagggtgccttctcggtggtccggaggtgcgtgaagaaaacgtcgacgcaggagtat
gcagcaaaaatcatcaataccaagaagttgtctgcccgagatcatcagaaactagaacga
gaggcccggatatgccgacttctgaaacatccaaacatcgtgcgtctccatgacagtatt
tctgaagaagggtttcactacctcgtgtttgaccttgttacgggaggggagttgtttgaa
gacatcgtggccagagaatactacagcgaagctgatgccagccactgtatacatcagatc
ctggagagcgtcaaccacatccaccagcatgacatcgtccaccgggacctgaagcccgag
aacttgctgctggcgagtaaatgcaagggtgctgcggtcaagctagctgattttggcctg
gccatcgaagtgcagggagagcagcaggcttggtttggttttgctggcaccccaggttac
ttgtcccctgaggtcttgaggaaagatccctatggaaaacctgtggatatctgggcctgc
ggggtcatcctgtatatcctcctggtgggctaccctcccttctgggatgaggatcagcac
aagctctatcagcagatcaaagctggagcctacgatttcccatcaccagaatgggacaca
gtcactcctgaagctaagaacttgatcaaccagatgttgaccataaaccctgcaaagcgt
atcacagctgaccaggctctcaagcacccatgggtctgtcaacggtcaacagtggcatcc
atgatgcatcgccaagagacagtggagtgcttacgcaagttcaacgcccggagaaaactg
aagggtgccatcctcacaaccatgcttgtctccaggaacttttcagttggcaggcagagc
tccgcccccgcctcgcctgccgcgagcgccgccggcctggccgggcaagctgccaagagc
ctattgaacaagaagtcagatggcggcgtcaagaaaaggaagtcgagttccagcgtgcac
ctaatggagccacaaaccaccgtggtacataatgctacagatgggatcaagggctccaca
gagagctgcaacaccaccacagaagacgaagatctcaaagtgcgaaaacaggagatcatt
aagatcacagaacagctgatagaagccatcaacaatggggactttgaggcctacacgaag
atttgtgacccaggcctcacttcctttgagccagaagcccttggtaacctcgtggagggg
atggatttccataagttttactttgagaatctcctgtccaagaacagcaagcctatccac
accaccatcctaaacccacatgtccatgtcatcggcgaggacgcagcttgcatcgcctac
atccggctcacccagtacatcgatgggcagggtcggcctcgcaccagtcagtcagaggag
acccgggtgtggcaccgccgggatggcaagtggctcaatgtccactatcactgctcagga
gcccctgctgcaccgctgcagtga

KEGG   Rattus norvegicus (rat): 171358
Entry
171358            CDS       T01003                                 

Gene name
Camk1g
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type 1G
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04921  Oxytocin signaling pathway
rno04925  Aldosterone synthesis and secretion
rno05214  Glioma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    171358 (Camk1g)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    171358 (Camk1g)
   04925 Aldosterone synthesis and secretion
    171358 (Camk1g)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    171358 (Camk1g)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    171358 (Camk1g)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     171358 (Camk1g)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   171358 (Camk1g)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like FTA2 Kdo APH RIO1 Pkinase_fungal DUF5898 CoV_S2_C 5_nucleotid YrbL-PhoP_reg CsgA
Other DBs
NCBI-GeneID: 171358
NCBI-ProteinID: NP_878262
RGD: 621800
Ensembl: ENSRNOG00000006470
UniProt: Q7TNJ7
Position
13
AA seq 476 aa
MGRKEEEDCSSWKKQTTNIRKTFIFMEVLGSGAFSEVFLVKQRVTGKLFALKCIKKSPAF
RDSSLENEIAVLKRIKHENIVTLEDIYESTTHYYLVMQLVSGGELFDRILERGVYTEKDA
SLVIQQVLSAVKYLHENGIVHRDLKPENLLYLTPEENSKIMITDFGLSKMEQNGVMSTAC
GTPGYVAPEVLAQKPYSKAVDCWSIGVITYILLCGYPPFYEETESKLFEKIKEGYYEFES
PFWDDISESAKDFICHLLEKDPNERYTCEKALRHPWIDGNTALHRDIYPSVSLQIQKNFA
KSKWRQAFNAAAVVHHMRKLHMNLHSPSVRQEVENRPPVSPAPEVSRPGSHDSSITEAPI
LDPSTPLPALTRLPCSHSSRPSAPGGRSLNCLVNGSLRISSSLVPMQQGPLATGPCGCCS
SCLNIGNKGKSSYCSEPTLFRKANKKQNFKSEVMVPVKAGGSTHCRAGQTGVCLIM
NT seq 1431 nt   +upstreamnt  +downstreamnt
atggggcgaaaggaggaggaggactgtagctcctggaagaaacagaccaccaacatcagg
aaaaccttcatcttcatggaagtgctcggatcaggagcgttctcagaggtgttcctggtg
aagcaaagagtgactgggaaactctttgctctgaagtgcatcaagaagtcaccagccttc
cgggacagtagcctagagaatgagattgctgtgttgaaaaggatcaagcatgaaaacatt
gtgaccctggaggatatctatgagagcaccacccactactacctggtcatgcagcttgtt
tctggaggtgagctttttgaccgaatcctagagcgtggtgtctacacagaaaaggatgcc
agtctggtcatccagcaggtcttgtctgccgtgaaataccttcatgagaatggcatcgtt
cacagagatctaaagcctgaaaacctgctgtacctcacccctgaggagaactccaagata
atgatcactgattttggcctatccaagatggagcagaatggagtcatgtccacagcttgt
gggaccccaggctatgtggctccagaagtgctggcccagaagccctacagtaaggctgtg
gactgctggtccattggtgtcatcacatacatactgctgtgtgggtatccccctttctat
gaagaaacagaatcaaagctttttgagaagatcaaagagggttactacgagtttgagtct
ccattctgggatgacatttctgagtcagccaaggactttatttgccatctgcttgagaag
gacccaaatgaacgatacacctgcgagaaagccctcagacacccttggattgacgggaac
acagccctgcaccgggacatctacccatctgtcagcctccagattcagaagaactttgcc
aagagcaagtggaggcaagccttcaatgcggccgccgtggtgcaccacatgaggaaacta
cacatgaacctgcacagccccagtgtccgccaagaagtggagaacaggccacctgtgtcc
cctgctcccgaagtctccagaccaggctcccatgacagctccatcacagaggctcccatc
ctggacccaagcacaccccttcctgcactgacccgacttccctgctcgcatagctctcgg
ccttcagctcctggtggccgctcactcaactgcctggtcaacggttctctgcgcatcagc
agtagcctagtgcccatgcaacagggtcccctagccacggggccctgcggctgctgctcc
agctgtctaaatatagggaacaagggaaagtcttcctattgctctgagcctaccctcttc
agaaaagccaacaaaaaacagaacttcaagtcagaggtcatggtaccagtgaaagcaggt
ggcagcacccactgccgggctgggcagactggggtgtgtctcataatgtga

KEGG   Rattus norvegicus (rat): 171503
Entry
171503            CDS       T01003                                 

Gene name
Camk1
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type 1
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04921  Oxytocin signaling pathway
rno04925  Aldosterone synthesis and secretion
rno05214  Glioma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    171503 (Camk1)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    171503 (Camk1)
   04925 Aldosterone synthesis and secretion
    171503 (Camk1)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    171503 (Camk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    171503 (Camk1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     171503 (Camk1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   171503 (Camk1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo Pkinase_fungal APH RIO1 Tyrosinase
Other DBs
NCBI-GeneID: 171503
NCBI-ProteinID: NP_604463
RGD: 629473
Ensembl: ENSRNOG00000021781
UniProt: Q63450
Structure
PDB: 
1A06 2L7L

Position
4
AA seq 374 aa
MPGAVEGPRWKQAEDIRDIYDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAKKALEGKE
GSMENEIAVLHKIKHPNIVALDDIYESGGHLYLIMQLVSGGELFDRIVEKGFYTERDASR
LIFQVLDAVKYLHDLGIVHRDLKPENLLYYSLDEDSKIMISDFGLSKMEDPGSVLSTACG
TPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDAKLFEQILKAEYEFDSP
YWDDISDSAKDFIRHLMEKDPEKRFTCEQALQHPWIAGDTALDKNIHQSVSEQIKKNFAK
SKWKQAFNATAVVRHMRKLQLGTSQEGQGQTASHGELLTPTAGGPAAGCCCRDCCVEPGS
ELPPAPPPSSRAMD
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgccaggggcagtggaaggccccaggtggaagcaggcagaagacattagggatatttat
gacttcagggatgttctgggcacgggtgccttctcagaagtgatcctggcagaggacaag
aggactcagaaactggtggccatcaaatgcattgccaagaaggccctggagggcaaagaa
ggcagcatggagaatgagatcgccgtcttacacaagatcaagcaccccaacattgtagcc
ctggatgacatctatgagagtgggggccacctctacctcatcatgcagctggtttcaggt
ggagagctgtttgaccgaattgtggagaaaggattctacacagaacgggatgccagccgc
ctcatcttccaggtgctggatgctgtcaagtacctgcacgacctgggcattgtgcaccgg
gatctcaagccagagaacctgctatactacagtctggatgaagactccaaaatcatgatc
tctgactttggcctctccaagatggaggacccaggcagtgtgctctccacagcctgtggg
actccaggatatgtggcccctgaggtcctggcccagaagccctacagcaaggccgtggac
tgctggtccataggagtcattgcctatatactgctctgtggctacccgccgttctatgat
gaaaatgatgccaaactttttgaacagattttgaaggctgagtatgagtttgactctcct
tattgggacgacatctctgactctgccaaagatttcatacgtcatttgatggagaaagac
ccagagaagaggttcacctgtgagcaggccttgcagcacccctggattgcaggagacaca
gctctggataagaatatccaccagtcagtgagtgagcagatcaagaagaactttgccaag
agcaagtggaagcaagctttcaatgctaccgctgtggttcggcacatgaggaagctgcag
ctgggcaccagccaggagggacagggacagacagctagccacggagagctgctgacaccc
acagctggggggccagcagctggctgctgctgtcgagactgctgtgtggagccaggctca
gaactgccccctgcaccacccccaagctctagggccatggactga

KEGG   Rattus norvegicus (rat): 24245
Entry
24245             CDS       T01003                                 

Gene name
Camk2b
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit beta isoform 2
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04012  ErbB signaling pathway
rno04020  Calcium signaling pathway
rno04024  cAMP signaling pathway
rno04066  HIF-1 signaling pathway
rno04114  Oocyte meiosis
rno04217  Necroptosis
rno04261  Adrenergic signaling in cardiomyocytes
rno04310  Wnt signaling pathway
rno04360  Axon guidance
rno04713  Circadian entrainment
rno04720  Long-term potentiation
rno04722  Neurotrophin signaling pathway
rno04725  Cholinergic synapse
rno04728  Dopaminergic synapse
rno04740  Olfactory transduction
rno04750  Inflammatory mediator regulation of TRP channels
rno04911  Insulin secretion
rno04912  GnRH signaling pathway
rno04916  Melanogenesis
rno04921  Oxytocin signaling pathway
rno04922  Glucagon signaling pathway
rno04925  Aldosterone synthesis and secretion
rno04934  Cushing syndrome
rno04971  Gastric acid secretion
rno05012  Parkinson disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05031  Amphetamine addiction
rno05152  Tuberculosis
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05214  Glioma
rno05415  Diabetic cardiomyopathy
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    24245 (Camk2b)
   04310 Wnt signaling pathway
    24245 (Camk2b)
   04066 HIF-1 signaling pathway
    24245 (Camk2b)
   04020 Calcium signaling pathway
    24245 (Camk2b)
   04024 cAMP signaling pathway
    24245 (Camk2b)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    24245 (Camk2b)
   04217 Necroptosis
    24245 (Camk2b)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    24245 (Camk2b)
   04922 Glucagon signaling pathway
    24245 (Camk2b)
   04912 GnRH signaling pathway
    24245 (Camk2b)
   04921 Oxytocin signaling pathway
    24245 (Camk2b)
   04916 Melanogenesis
    24245 (Camk2b)
   04925 Aldosterone synthesis and secretion
    24245 (Camk2b)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    24245 (Camk2b)
  09154 Digestive system
   04971 Gastric acid secretion
    24245 (Camk2b)
  09156 Nervous system
   04725 Cholinergic synapse
    24245 (Camk2b)
   04728 Dopaminergic synapse
    24245 (Camk2b)
   04720 Long-term potentiation
    24245 (Camk2b)
   04722 Neurotrophin signaling pathway
    24245 (Camk2b)
  09157 Sensory system
   04740 Olfactory transduction
    24245 (Camk2b)
   04750 Inflammatory mediator regulation of TRP channels
    24245 (Camk2b)
  09158 Development and regeneration
   04360 Axon guidance
    24245 (Camk2b)
  09159 Environmental adaptation
   04713 Circadian entrainment
    24245 (Camk2b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24245 (Camk2b)
   05205 Proteoglycans in cancer
    24245 (Camk2b)
  09162 Cancer: specific types
   05214 Glioma
    24245 (Camk2b)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    24245 (Camk2b)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    24245 (Camk2b)
   05022 Pathways of neurodegeneration - multiple diseases
    24245 (Camk2b)
  09165 Substance dependence
   05031 Amphetamine addiction
    24245 (Camk2b)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    24245 (Camk2b)
   05415 Diabetic cardiomyopathy
    24245 (Camk2b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    24245 (Camk2b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    24245 (Camk2b)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     24245 (Camk2b)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   24245 (Camk2b)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr DUF4440 SnoaL_3 APH SnoaL_2 Pkinase_fungal Kdo SnoaL_4 TCAD9
Other DBs
NCBI-GeneID: 24245
NCBI-ProteinID: NP_068507
RGD: 2262
Ensembl: ENSRNOG00000052080
UniProt: P08413 G3V9G3
Structure
PDB: 
6HCS

Position
14
AA seq 542 aa
MATTVTCTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLER
EARICRLLKHSNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LEAVLHCHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITAHEALKHPWVCQRSTVASMMHRQETVECLKKFNARRKL
KGAILTTMLATRNFSVGRQTTAPATMSTAASGTTMGLVEQAKSLLNKKADGVKPQTNSTK
NSSAITSPKGSLPPAALEPQTTVIHNPVDGIKESSDSTNTTIEDEDAKARKQEIIKTTEQ
LIEAVNNGDFEAYAKICDPGLTSFEPEALGNLVEGMDFHRFYFENLLAKNSKPIHTTILN
PHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWQNVHFHCSGAPVAP
LQ
NT seq 1629 nt   +upstreamnt  +downstreamnt
atggccaccacggtgacctgcacccgtttcacggacgagtaccagctatacgaggatatt
ggcaagggggctttctctgtggtccgacgctgtgtcaagctctgcaccggccatgagtat
gcagctaagatcattaacaccaagaagctgtcagctagagatcaccagaagctggagagg
gaggctcggatctgccgcctgctgaagcattccaacattgtacgcctccatgacagcatc
tctgaagagggcttccactacctggtcttcgacctggtcactggtggggagctctttgaa
gacattgtggcgagagagtactacagtgaggctgacgccagtcactgtatccagcagatc
ctggaggctgttctccattgtcaccaaatgggggtcgtccacagagacctcaagcctgaa
aacctgctcctggccagcaaatgcaaaggggccgcagtgaaactggcagacttcggcctg
gccatcgaggttcagggagaccagcaggcatggtttggatttgcgggaacaccaggctac
ctgtctcccgaagttcttcggaaggaggcctatggcaaaccagtggatatctgggcatgt
ggggtgatcctgtatatcctgctggtgggatacccacctttctgggatgaggaccagcac
aagctgtaccagcagatcaaggctggggcctatgacttcccatcccccgagtgggacacc
gttacccctgaagccaaaaacctcatcaaccagatgttgaccatcaaccccgccaagcgc
atcacggcccacgaggccctgaagcacccatgggtctgccaacgatccacggtggcctcc
atgatgcacagacaggagactgtggaatgtctgaagaagttcaatgcaaggaggaagctc
aagggagccatcctcaccactatgctggccacacggaatttctcagtgggcagacagacc
accgctccggccacaatgtccaccgcggcctccggcaccaccatggggctggtggaacaa
gccaagagtttactcaacaagaaagcagacggagtcaagccccagacaaacagcaccaaa
aacagctcggccatcaccagccccaaaggatccctccctcctgccgccctggagcctcaa
accaccgttatccataacccagtggacggcattaaggaatcttccgacagcaccaacaca
accatagaggacgaagatgccaaagcccggaagcaggaaatcatcaagaccacagagcag
ctcatcgaggccgtcaacaacggcgactttgaggcctatgcgaaaatctgtgacccaggc
ctgacctcatttgagcctgaagctctgggcaacctggtcgaagggatggatttccacaga
ttctactttgagaacctgctggccaagaacagcaagccgatccacaccactatcctgaac
ccgcacgtgcacgtcatcggcgaggatgcagcctgcatcgcttacatccgcctcacacag
tacatcgacggccagggcagaccccgcaccagccagtccgaagagacccgtgtgtggcac
cgccgcgacggcaagtggcagaatgtccatttccactgctcgggcgctccagtggcccca
ctgcagtga

KEGG   Rattus norvegicus (rat): 24246
Entry
24246             CDS       T01003                                 

Gene name
Camk2d
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit delta
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04012  ErbB signaling pathway
rno04020  Calcium signaling pathway
rno04024  cAMP signaling pathway
rno04066  HIF-1 signaling pathway
rno04114  Oocyte meiosis
rno04217  Necroptosis
rno04261  Adrenergic signaling in cardiomyocytes
rno04310  Wnt signaling pathway
rno04360  Axon guidance
rno04713  Circadian entrainment
rno04720  Long-term potentiation
rno04722  Neurotrophin signaling pathway
rno04725  Cholinergic synapse
rno04728  Dopaminergic synapse
rno04740  Olfactory transduction
rno04750  Inflammatory mediator regulation of TRP channels
rno04911  Insulin secretion
rno04912  GnRH signaling pathway
rno04916  Melanogenesis
rno04921  Oxytocin signaling pathway
rno04922  Glucagon signaling pathway
rno04925  Aldosterone synthesis and secretion
rno04934  Cushing syndrome
rno04971  Gastric acid secretion
rno05012  Parkinson disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05031  Amphetamine addiction
rno05152  Tuberculosis
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05214  Glioma
rno05415  Diabetic cardiomyopathy
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    24246 (Camk2d)
   04310 Wnt signaling pathway
    24246 (Camk2d)
   04066 HIF-1 signaling pathway
    24246 (Camk2d)
   04020 Calcium signaling pathway
    24246 (Camk2d)
   04024 cAMP signaling pathway
    24246 (Camk2d)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    24246 (Camk2d)
   04217 Necroptosis
    24246 (Camk2d)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    24246 (Camk2d)
   04922 Glucagon signaling pathway
    24246 (Camk2d)
   04912 GnRH signaling pathway
    24246 (Camk2d)
   04921 Oxytocin signaling pathway
    24246 (Camk2d)
   04916 Melanogenesis
    24246 (Camk2d)
   04925 Aldosterone synthesis and secretion
    24246 (Camk2d)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    24246 (Camk2d)
  09154 Digestive system
   04971 Gastric acid secretion
    24246 (Camk2d)
  09156 Nervous system
   04725 Cholinergic synapse
    24246 (Camk2d)
   04728 Dopaminergic synapse
    24246 (Camk2d)
   04720 Long-term potentiation
    24246 (Camk2d)
   04722 Neurotrophin signaling pathway
    24246 (Camk2d)
  09157 Sensory system
   04740 Olfactory transduction
    24246 (Camk2d)
   04750 Inflammatory mediator regulation of TRP channels
    24246 (Camk2d)
  09158 Development and regeneration
   04360 Axon guidance
    24246 (Camk2d)
  09159 Environmental adaptation
   04713 Circadian entrainment
    24246 (Camk2d)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24246 (Camk2d)
   05205 Proteoglycans in cancer
    24246 (Camk2d)
  09162 Cancer: specific types
   05214 Glioma
    24246 (Camk2d)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    24246 (Camk2d)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    24246 (Camk2d)
   05022 Pathways of neurodegeneration - multiple diseases
    24246 (Camk2d)
  09165 Substance dependence
   05031 Amphetamine addiction
    24246 (Camk2d)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    24246 (Camk2d)
   05415 Diabetic cardiomyopathy
    24246 (Camk2d)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    24246 (Camk2d)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    24246 (Camk2d)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     24246 (Camk2d)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   24246 (Camk2d)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr DUF4440 SnoaL_3 Pkinase_fungal SnoaL_2 Kdo SnoaL_4 DUF4915
Other DBs
NCBI-GeneID: 24246
NCBI-ProteinID: NP_036651
RGD: 2263
Ensembl: ENSRNOG00000011589
UniProt: P15791
Structure
PDB: 
6HCS

Position
2
AA seq 533 aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDT
VTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKL
KGAILTTMLATRNFSAAKSLLKKPDGVKINNKANVVTSPKENIPTPALEPQTTVIHNPDG
NKESTESSNTTIEDEDVKARKQEIIKVTEQLIEAINNGDFEAYTKICDPGLTAFEPEALG
NLVEGMDFHRFYFENALPKINKPIHTIILNPHVHLVGDDAACIAYIRLTQYMDGNGMPKT
MQSEETRVWHRRDGKWQNIHFHRSGSPTVPIKPPCIPNGKENFSGGTSLWQNI
NT seq 1602 nt   +upstreamnt  +downstreamnt
atggcttcgaccaccacctgcacccggttcaccgacgagtatcagctcttcgaggagctc
ggaaagggggcattctcagtggtgagaagatgcatgaaaatccctactggacaagagtat
gctgccaaaattatcaacaccaaaaagctttctgctagggatcatcagaaactggaaagg
gaagctagaatctgccgtctcttgaagcaccccaatattgtgagacttcatgacagcata
tccgaagagggcttccattacttggtgtttgacttagttactggtggcgaactctttgaa
gacatagtggcaagagaatattacagtgaggctgatgccagtcattgtatacaacagatt
ctagagagtgtaaatcattgtcacctaaatggcatagttcacagggacctgaagcctgag
aatttgcttttagctagcaaatccaaaggagcagctgtgaaactggcagacttcggctta
gccatagaagttcaaggcgaccagcaggcgtggtttggttttgctggcacacctgggtat
ctttctccagaagtcctacgtaaagatccttatggaaaaccagtggacatgtgggcatgt
ggcgtcatcctctacatcttgctggtgggatacccacccttctgggatgaagatcagcat
agactgtatcagcagatcaaggctggagcgtacgattttccatcaccagaatgggacaca
gtgacacctgaagccaaagacctcatcaacaaaatgctgaccatcaaccctgccaaacgc
atcacagcctctgaggccctgaaacacccatggatctgtcaacgttctactgttgcctcc
atgatgcacaggcaggagactgtagactgcttgaagaaatttaatgctcgacggaaattg
aagggtgccatcttgacaactatgctggctacgagaaatttttcagcagccaagagtttg
ttgaagaaaccggatggggtaaagataaacaacaaagccaacgtggtaaccagccccaaa
gaaaatattcctaccccggcgctggagccccaaactactgtaatccacaaccctgatgga
aacaaggagtcaactgagagctcaaataccaccattgaggatgaagacgtgaaagcacga
aagcaagagatcatcaaagtcactgagcagctgattgaagctatcaacaatggggacttc
gaggcttacacgaaaatctgtgatccaggcctcactgcctttgaacccgaagcattgggc
aacttagtggaagggatggactttcacagattctactttgaaaatgctttgcccaaaatc
aataaaccaatccacactatcatcctgaaccctcacgtacacctggtaggggatgatgca
gcctgcatagcatacattcggctcacacagtacatggatggaaatggaatgccaaagaca
atgcagtcagaagagactcgagtgtggcaccgccgtgatgggaagtggcagaatattcac
tttcatcgttcggggtccccaacagtccccatcaagccaccctgtattccaaatgggaaa
gaaaacttctcaggaggcacctctttgtggcaaaacatctga

KEGG   Rattus norvegicus (rat): 25050
Entry
25050             CDS       T01003                                 

Gene name
Camk4
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type IV
  KO
K05869  calcium/calmodulin-dependent protein kinase IV [EC:2.7.11.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04024  cAMP signaling pathway
rno04211  Longevity regulating pathway
rno04371  Apelin signaling pathway
rno04380  Osteoclast differentiation
rno04720  Long-term potentiation
rno04722  Neurotrophin signaling pathway
rno04725  Cholinergic synapse
rno04921  Oxytocin signaling pathway
rno04925  Aldosterone synthesis and secretion
rno05031  Amphetamine addiction
rno05034  Alcoholism
rno05214  Glioma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    25050 (Camk4)
   04020 Calcium signaling pathway
    25050 (Camk4)
   04024 cAMP signaling pathway
    25050 (Camk4)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    25050 (Camk4)
   04925 Aldosterone synthesis and secretion
    25050 (Camk4)
  09156 Nervous system
   04725 Cholinergic synapse
    25050 (Camk4)
   04720 Long-term potentiation
    25050 (Camk4)
   04722 Neurotrophin signaling pathway
    25050 (Camk4)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    25050 (Camk4)
  09149 Aging
   04211 Longevity regulating pathway
    25050 (Camk4)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    25050 (Camk4)
  09165 Substance dependence
   05031 Amphetamine addiction
    25050 (Camk4)
   05034 Alcoholism
    25050 (Camk4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    25050 (Camk4)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     25050 (Camk4)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   25050 (Camk4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like FTA2 Kdo YrbL-PhoP_reg APH
Other DBs
NCBI-GeneID: 25050
NCBI-ProteinID: NP_036859
RGD: 2264
Ensembl: ENSRNOG00000020478
UniProt: P13234
Position
18
AA seq 474 aa
MLKVTVPSCPSSPCSSVTSSTENLVPDYWIDGSKRDPLSDFFEVESELGRGATSIVYRCK
QKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLELVTGG
ELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAPLKIA
DFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEPFYDE
RGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVKKLIVLDPKKRLTTFQALQHPWVTGKA
ANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSSHTNIQESNKASSEAQPAQD
GKDKTDPLENKMQAGDHEAAKAAADETMKLQSEEVEEEEGVKEEEEEEEEEEETSRMVPQ
EPEDRLETDDQEMKRNSEETLKSVEEEMDPKAEEEAAAVGLGVPPQQDAILPEY
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgctcaaagtcacggtgccctcctgtccctcctcgccctgctcctcggtcacctccagt
actgagaacctcgtcccggattactggatcgacggctctaaacgggatcctctgagcgat
ttcttcgaggtggagtcagagctgggacggggtgctacatccattgtgtacagatgcaaa
cagaaggggacccagaagccctatgctctcaaagtgttaaagaaaacagtggacaagaag
atcgtgagaactgaaataggagttctcctgagactctcacacccgaacatcataaaactc
aaggaaatatttgaaacccccacagaaatcagcctggttcttgagctagtcacaggagga
gaactgtttgacaggattgtggagaaaggctattacagtgaacgcgacgcggccgatgct
gtgaagcagatcctggaggcagttgcttacctgcacgaaaatggaatcgtccatcgcgac
ctcaaaccagagaatcttctttatgcaacgccagcccctgatgcaccactcaaaattgct
gattttggactttctaaaatcgtggaacatcaagtgctcatgaagacggtgtgtggaacc
ccggggtactgtgcacctgagattctccgaggctgtgcctatggccccgaggtggacatg
tggtctgtaggaataattacctacatcctactttgtggatttgaaccattctatgatgag
agaggtgatcagttcatgttcaggagaattctgaattgtgaatattactttatctccccc
tggtgggatgaagtttctttaaatgccaaggacttggtcaagaaactcattgttttggac
cctaagaagcggctgactacattccaagccctccaacacccgtgggtcacaggaaaagca
gccaactttgtccacatggataccgctcagaaaaagcttcaagaattcaatgctaggcgc
aagcttaaggcggcagtgaaggctgtggtggcctcttctcggctgggaagtgccagcagc
agtcacaccaacatccaagaaagcaacaaagccagctcggaggcacagcccgcccaagac
ggcaaggacaagacagatcctctggaaaacaaaatgcaagcgggggaccacgaggcagcc
aaggctgcagccgatgagacgatgaagctacagtccgaggaggtggaggaagaggaaggt
gtaaaagaagaggaggaagaggaagaagaggaagaggagacctccaggatggtacctcag
gagccagaggacaggctggagacagatgaccaggaaatgaagagaaattcagaggagacg
ttgaagagtgtggaggaagaaatggacccgaaagctgaggaggaagccgctgccgtggga
cttggggtccctccacagcaggatgctattctgccagagtactaa

KEGG   Rattus norvegicus (rat): 25400
Entry
25400             CDS       T01003                                 

Gene name
Camk2a
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit alpha
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04012  ErbB signaling pathway
rno04020  Calcium signaling pathway
rno04024  cAMP signaling pathway
rno04066  HIF-1 signaling pathway
rno04114  Oocyte meiosis
rno04217  Necroptosis
rno04261  Adrenergic signaling in cardiomyocytes
rno04310  Wnt signaling pathway
rno04360  Axon guidance
rno04713  Circadian entrainment
rno04720  Long-term potentiation
rno04722  Neurotrophin signaling pathway
rno04725  Cholinergic synapse
rno04728  Dopaminergic synapse
rno04740  Olfactory transduction
rno04750  Inflammatory mediator regulation of TRP channels
rno04911  Insulin secretion
rno04912  GnRH signaling pathway
rno04916  Melanogenesis
rno04921  Oxytocin signaling pathway
rno04922  Glucagon signaling pathway
rno04925  Aldosterone synthesis and secretion
rno04934  Cushing syndrome
rno04971  Gastric acid secretion
rno05012  Parkinson disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05031  Amphetamine addiction
rno05152  Tuberculosis
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05214  Glioma
rno05415  Diabetic cardiomyopathy
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    25400 (Camk2a)
   04310 Wnt signaling pathway
    25400 (Camk2a)
   04066 HIF-1 signaling pathway
    25400 (Camk2a)
   04020 Calcium signaling pathway
    25400 (Camk2a)
   04024 cAMP signaling pathway
    25400 (Camk2a)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    25400 (Camk2a)
   04217 Necroptosis
    25400 (Camk2a)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    25400 (Camk2a)
   04922 Glucagon signaling pathway
    25400 (Camk2a)
   04912 GnRH signaling pathway
    25400 (Camk2a)
   04921 Oxytocin signaling pathway
    25400 (Camk2a)
   04916 Melanogenesis
    25400 (Camk2a)
   04925 Aldosterone synthesis and secretion
    25400 (Camk2a)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    25400 (Camk2a)
  09154 Digestive system
   04971 Gastric acid secretion
    25400 (Camk2a)
  09156 Nervous system
   04725 Cholinergic synapse
    25400 (Camk2a)
   04728 Dopaminergic synapse
    25400 (Camk2a)
   04720 Long-term potentiation
    25400 (Camk2a)
   04722 Neurotrophin signaling pathway
    25400 (Camk2a)
  09157 Sensory system
   04740 Olfactory transduction
    25400 (Camk2a)
   04750 Inflammatory mediator regulation of TRP channels
    25400 (Camk2a)
  09158 Development and regeneration
   04360 Axon guidance
    25400 (Camk2a)
  09159 Environmental adaptation
   04713 Circadian entrainment
    25400 (Camk2a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25400 (Camk2a)
   05205 Proteoglycans in cancer
    25400 (Camk2a)
  09162 Cancer: specific types
   05214 Glioma
    25400 (Camk2a)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    25400 (Camk2a)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    25400 (Camk2a)
   05022 Pathways of neurodegeneration - multiple diseases
    25400 (Camk2a)
  09165 Substance dependence
   05031 Amphetamine addiction
    25400 (Camk2a)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    25400 (Camk2a)
   05415 Diabetic cardiomyopathy
    25400 (Camk2a)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    25400 (Camk2a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    25400 (Camk2a)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     25400 (Camk2a)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   25400 (Camk2a)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr DUF4440 SnoaL_3 APH Kdo Pkinase_fungal SnoaL_2 SnoaL_4 TCAD9
Other DBs
NCBI-GeneID: 25400
NCBI-ProteinID: NP_037052
RGD: 2261
Ensembl: ENSRNOG00000018712
UniProt: P11275
Structure
PDB: 
6HCS 5U6Y

Position
18
AA seq 478 aa
MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLERE
ARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQIL
EAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYL
SPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV
TPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK
GAILTTMLATRNFSGGKSGGNKKNDGVKESSESTNTTIEDEDTKVRKQEIIKVTEQLIEA
ISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKPVHTTILNPHIH
LMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHRSGAPSVLPH
NT seq 1437 nt   +upstreamnt  +downstreamnt
atggctaccatcacctgcacccgattcacggaagagtaccagctcttcgaggaactggga
aagggagccttctccgtggtgcgcaggtgtgtgaaggtgctggctggccaggagtatgct
gccaagattatcaacaccaagaagctctcagccagagatcaccagaagttggaacgcgag
gcccgcatctgccgcttgttgaagcaccccaatatcgtccgactccatgacagcatctcc
gaggaggggcaccactaccttatcttcgatctggtcactggtggggagctgttcgaagac
attgtggcccgggagtattacagtgaggctgatgccagccactgtatccagcagatcctg
gaggctgtgctacactgtcaccagatgggggtggtgcatcgcgacctgaagcctgagaat
ctgttgctggcttcgaagctcaagggtgctgcggtgaagctggcagactttggcctggcc
atagaggttgagggagagcagcaggcatggtttgggttcgcagggacacctggatacctc
tccccagaagtgctgcggaaggacccatacgggaagcctgtggacctgtgggcctgtggc
gtcatcctgtatatcttgctggttgggtatcccccattctgggatgaggaccagcaccgc
ctgtaccagcagatcaaagctggtgcctacgatttcccatcaccagaatgggacaccgtc
accccggaagccaaggatctgatcaataagatgctgaccatcaacccgtccaaacgcatc
acggccgctgaggctctcaagcacccctggatctcgcaccgctccactgtggcctcctgc
atgcacagacaggagaccgtggactgcctgaagaagttcaatgccaggaggaaactgaag
ggagccatcctcaccactatgctggccaccaggaacttctccggagggaagagtggagga
aacaagaagaatgatggcgtgaaggaatcctctgagagcaccaacaccaccatcgaggat
gaagacaccaaagtgcgcaaacaggaaattatcaaagtgacagagcagctgatcgaagcc
ataagcaatggagactttgaatcctacacgaagatgtgcgaccctggaatgacagccttt
gaaccggaggccctggggaacctggtcgagggcctggactttcatcgattctattttgaa
aacctgtggtcccggaacagcaagcccgtgcacaccaccatcctgaaccctcacatccac
ctgatgggtgacgagtcagcctgcatcgcctacatccgcatcactcagtacctggatgcg
ggtggcatcccccgcacggcccagtcagaggagacccgtgtctggcaccgcagggatgga
aaatggcagatcgtccacttccacagatctggggcgccctccgtcctgccccattga

DBGET integrated database retrieval system