KEGG   Rattus norvegicus (rat): 171142Help
Entry
171142            CDS       T01003                                 

Gene name
Ehhadh, Lbp, MEF, Mfe, Mfe1, Pbe, Pbfe, pe-CoA, perMFE-1
Definition
(RefSeq) enoyl-CoA hydratase and 3-hydroxyacyl CoA dehydrogenase
  KO
K07514  enoyl-CoA hydratase / 3-hydroxyacyl-CoA dehydrogenase / 3,2-trans-enoyl-CoA isomerase [EC:4.2.1.17 1.1.1.35 5.3.3.8]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00071  Fatty acid degradation
rno00280  Valine, leucine and isoleucine degradation
rno00310  Lysine degradation
rno00380  Tryptophan metabolism
rno00410  beta-Alanine metabolism
rno00640  Propanoate metabolism
rno00650  Butanoate metabolism
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno01212  Fatty acid metabolism
rno03320  PPAR signaling pathway
rno04146  Peroxisome
Module
rno_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
rno_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
rno_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    171142 (Ehhadh)
   00650 Butanoate metabolism
    171142 (Ehhadh)
  Lipid metabolism
   00071 Fatty acid degradation
    171142 (Ehhadh)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    171142 (Ehhadh)
   00310 Lysine degradation
    171142 (Ehhadh)
   00380 Tryptophan metabolism
    171142 (Ehhadh)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    171142 (Ehhadh)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    171142 (Ehhadh)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    171142 (Ehhadh)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     171142 (Ehhadh)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     171142 (Ehhadh)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     171142 (Ehhadh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 Peptidase_S49 NAD_binding_2 F420_oxidored UDPG_MGDP_dh_N 2-Hacid_dh_C TrkA_N ApbA
Motif
Other DBs
NCBI-GeneID: 171142
NCBI-ProteinID: NP_598290
RGD: 621441
Ensembl: ENSRNOG00000001770
UniProt: P07896
Structure
PDB: 

Position
11q23
AA seq 722 aa AA seqDB search
MAEYLRLPHSLAMIRLCNPPVNAVSPTVIREVRNGLQKAGSDHTVKAIVICGANGNFCAG
ADIHGFSAFTPGLALGSLVDEIQRYQKPVLAAIQGVALGGGLELALGCHYRIANAKARVG
LPEVTLGILPGARGTQLLPRVVGVPVALDLITSGKYLSADEALRLGILDAVVKSDPVEEA
IKFAQKIIDKPIEPRRIFNKPVPSLPNMDSVFAEAIAKVRKQYPGVLAPETCVRSIQASV
KHPYEVGIKEEEKLFMYLRASGQAKALQYAFFAEKSANKWSTPSGASWKTASAQPVSSVG
VLGLGTMGRGIAISFARVGISVVAVESDPKQLDAAKKIITFTLEKEASRAHQNGQASAKP
KLRFSSSTKELSTVDLVVEAVFEDMNLKKKVFAELSALCKPGAFLCTNTSALNVDDIASS
TDRPQLVIGTHFFSPAHVMRLLEVIPSRYSSPTTIATVMSLSKKIGKIGVVVGNCYGFVG
NRMLAPYYNQGFFLLEEGSKPEDVDGVLEEFGFKMGPFRVSDLAGLDVGWKIRKGQGLTG
PSLPPGTPVRKRGNSRYSPLGDMLCEAGRFGQKTGKGWYQYDKPLGRIHKPDPWLSTFLS
QYREVHHIEQRTISKEEILERCLYSLINEAFRILEEGMAARPEHIDVIYLHGYGWPRHKG
GPMFYAASVGLPTVLEKLQKYYRQNPDIPQLEPSDYLRRLVAQGSPPLKEWQSLAGPHGS
KL
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atggctgagtatctgaggctgccccactccctggcgatgatccgcctctgcaacccgcca
gtcaacgccgtcagtccaactgtaatcagggaagtaagaaatggactccagaaagctgga
tcagaccacacggttaaagccattgtgatctgtggcgcaaacggaaacttctgtgcaggt
gctgatatccatggctttagtgcttttacccctggccttgcattaggaagcttggtagat
gaaatacagagataccagaagccggtgttggccgctatccaaggtgtggctctcggagga
ggactggagctggccttgggctgtcactatcggattgccaatgcaaaggctcgtgtcggc
ttgccagaagtcacactggggattcttcctggtgcaagaggaacccagcttctccccagg
gtcgttggagttcctgttgctcttgacctaattacctcaggaaaatatctttcagcagat
gaagcactcaggcttggaattctggatgcagtcgtgaagtcagacccagttgaagaagcc
atcaaatttgctcagaagattatagataaacccatagaaccccgcaggatctttaacaag
ccagttccaagcttgcccaacatggacagtgtttttgcagaagccatcgccaaggtacga
aaacagtaccctggtgtcctggctccggagacgtgtgtccgctcaatccaggcctctgtg
aagcatccctacgaagtaggcatcaaggaagaggaaaagctgtttatgtacctccgggca
tccgggcaggctaaagccctacagtatgccttctttgctgaaaagtctgcaaataagtgg
tcaactccctcaggagcgtcttggaaaacagcctctgctcaacccgtctcctcagttggc
gttcttggcttgggaacgatgggccgaggcatcgccatttcttttgcgagagtggggatc
tctgtggttgctgtggagtcagacccaaagcagctagatgctgcaaagaagataatcact
ttcaccttggagaaggaagcatccagagcgcatcagaacggccaagcttcggcaaaacca
aaactcaggttctcctcatccacaaaggaactttcaactgtggatttggtggttgaagca
gtgttcgaagacatgaacctgaagaaaaaggtctttgctgagctgtcagccctgtgcaag
ccaggagcctttctgtgcaccaatacctcggcgctgaacgtggacgacattgcttcttcc
acagatcgccctcagctggtgattggcacccacttcttctcaccagcccatgtcatgagg
ttgctagaggtcattcctagccgatactcttcccctactaccatcgccacggttatgagc
ttgtccaaaaagatcggaaagattggagtagtggttggcaactgctatggatttgttggg
aatcggatgttggctccctattacaaccaggggtttttcttgttagaggaaggtagcaag
ccagaggatgtagacggggtcttggaagagtttggttttaaaatgggacccttcagagtg
tcagacctcgcagggctagatgtgggttggaaaattcgcaaggggcaaggccttactgga
ccatcattgccaccagggacccccgtccgaaagaggggcaacagcaggtactccccactt
ggcgatatgctctgtgaagctgggcggtttggtcagaagacaggtaaaggctggtatcag
tatgacaagccactgggtcgcatccacaaacctgatccctggctttctacgttcctgtca
caatatagagaggttcaccacatcgagcagcgcaccatcagcaaggaggagatcctggag
cgttgcttatattccctcatcaatgaggcgttccgcatcttggaggaggggatggctgct
cgcccagagcacattgatgtcatctacttgcacgggtacgggtggccaaggcacaagggc
gggcccatgttctatgctgcctcagttgggttgcccacagttctagagaaactgcagaaa
tattacaggcagaaccctgacatcccccagctggagcccagtgactacctcagaaggctg
gtagcccagggaagccctcctctgaaggaatggcaaagcttggcagggccccacggcagc
aaactgtga

DBGET integrated database retrieval system