KEGG   Rattus norvegicus (rat): 171150
Entry
171150            CDS       T01003                                 

Gene name
Cdk7
Definition
(RefSeq) cyclin-dependent kinase 7
  KO
K02202  cyclin-dependent kinase 7 [EC:2.7.11.22 2.7.11.23]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03022  Basal transcription factors
rno03420  Nucleotide excision repair
rno04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    171150 (Cdk7)
  09124 Replication and repair
   03420 Nucleotide excision repair
    171150 (Cdk7)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    171150 (Cdk7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    171150 (Cdk7)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    171150 (Cdk7)
   03019 Messenger RNA biogenesis [BR:rno03019]
    171150 (Cdk7)
   03400 DNA repair and recombination proteins [BR:rno03400]
    171150 (Cdk7)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     171150 (Cdk7)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     171150 (Cdk7)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  CDK family
   171150 (Cdk7)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     171150 (Cdk7)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA processing factors
   5' end processing
    Capping factors
     171150 (Cdk7)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     171150 (Cdk7)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 APH Pkinase_fungal RIO1
Other DBs
NCBI-GeneID: 171150
NCBI-ProteinID: XP_008773277
RGD: 621124
Ensembl: ENSRNOG00000018510
Position
2q12
AA seq 346 aa
MAVDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTAL
REIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLM
TLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRA
PELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDM
CSLPDYVTFKSFPGIPLQHIFIAAGDDLLELIQGLFLFNPCTRITASQALRTKYFSNRPG
PTPGCQLPRPNCPVEALKEQSNPAMATKRKRAEALEQGILPKKLIF
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggctgtggacgtgaaatctcgagcgaagcgctatgagaaactggacttcctcggagag
ggacagtttgctactgtctataaggccagagataagaacaccaaccagatcgtcgccatt
aagaaaatcaaacttggacacaggtcagaagctaaagatggtataaatagaacagcctta
agggagataaagctcttgcaggaactaagtcatccaaatataattggtctccttgatgca
tttggacataaatcgaacattagccttgtctttgattttatggagactgacctagaggtt
atcataaaggataacagtctcgtgttgaccccatcccacattaaagcctacatgctgatg
actcttcagggcttggaatatttacatcagcactggattctacacagggatctgaaacca
aacaacttgttgttagatgagaatggagttctgaaactggcagattttggcctggccaaa
tcatttgggagccccaatagggcttacacacatcaagttgtgaccaggtggtaccgggcc
cccgagttactgtttggagctaggatgtacggtgtgggagtggacatgtgggctgtcggt
tgtatcttagcagaattgcttctaagggttccttttttgcctggagattcagaccttgat
cagctaacaagaatatttgaaactctgggtacaccaaccgaagaacagtggcctgacatg
tgtagtcttccagattacgtgacgttcaagagtttccctggcatccccctgcagcacatc
ttcattgcagctggagacgacctgcttgagctcatacaaggcttgttcttattcaaccca
tgtactagaattacagcttcacaggcgttgaggaccaagtacttcagtaatcgtccaggg
ccaacacctggatgccagcttccaagaccaaactgtccagtggaagcattaaaggaacag
tcaaatccagccatggcgacaaaacggaaaagagcggaggccttagaacaaggaatattg
cccaagaagctaattttttag

DBGET integrated database retrieval system