KEGG   Rattus norvegicus (rat): 171158
Entry
171158            CDS       T01003                                 

Gene name
Gpha2, Gpa2, Zsig51
Definition
(RefSeq) glycoprotein hormone alpha 2
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Hormone_6 Cys_knot DAN
Other DBs
NCBI-GeneID: 171158
NCBI-ProteinID: NP_598303
RGD: 621748
Ensembl: ENSRNOG00000021020
UniProt: Q925Q4 A0A0F7RPV4
Position
1q43
AA seq 130 aa
MPMAPRVLLFCLLGLAVTEGHGLEAAVPIPGCHLHPFNVTVRSDRHGTCQGSHVAQACVG
HCESSAFPSRYSVLVASGYRHNITSVSQCCTISSLKKVRVWLHCVGNQRGELEIFTARAC
QCDMCRLSRY
NT seq 393 nt   +upstreamnt  +downstreamnt
atgcccatggcacctcgagtcttgctcttctgcctgctgggtctggcagtcactgaaggg
catggcctggaggcagccgtcccaatcccaggctgccacttgcacccctttaacgtgaca
gtgcgaagtgatcgccatggcacctgccagggctcccatgtggcacaggcgtgtgtagga
cactgtgagtctagtgctttcccttctcggtactctgtgctggttgccagtggctatcga
cacaacatcacctctgtctctcagtgctgtaccatcagcagccttaaaaaggtgagggtg
tggctgcactgcgtggggaaccagcgtggggagctcgagatcttcacggctagggcctgc
cagtgtgatatgtgccgtctctcccgctactag

DBGET integrated database retrieval system