KEGG   Rattus norvegicus (rat): 171159Help
Entry
171159            CDS       T01003                                 

Gene name
Zhx1
Definition
(RefSeq) zinc fingers and homeoboxes 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain zf_C2H2_ZHX Homez Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 171159
NCBI-ProteinID: NP_598304
RGD: 620010
Ensembl: ENSRNOG00000006412
UniProt: Q8R515
Position
7q33
AA seq 873 aa AA seqDB search
MASRRKSTTPCMVLASEQDPDLELISDLEEGPPVLTPVENARAESVSSDEEVHESVDSDN
QQNKKVEGGYECKYCTFQTPDLNMFTFHVDSEHPNVVLNSSYVCVECNFLTKRYDALSEH
NLKYHPGEENFKLTMVKRNNQTIFEQTINDLTFDGSFVKEENTEQGESIDVSSSGISISK
TPIMKMMKNKVENKRITVHHNSAEGTSEEKENGVKASREENAENTSSSASESNTSTSTVN
QVHPSPAGTVVTPTAVLPGLAQVITAVSAQQNSNLVPKVLIPVNSIPTYNAALDNNPLLL
NTYNKFPYPTMSEITVLSAQAKYTEEQIKIWFSAQRLKHGVSWTPEEVEEARRKQFNGTV
HTVPQTITVIPTHISTGSNGLPSILQTCQIVGQPGLVLTQVAGANTLPVTAPIALTVAGV
PNQTNVQKSQVPAAQPAAETKPATAAVPSSPSVRPEAALVNPDSFGIRAKKTKEQLAELK
VSYLKNQFPHDSEIIRLMKITGLTKGEIKKWFSDTRYNQRNSKSNQCLHLNNDSSATIII
DSSDETPEPPAAAASQPKQSWNPFPDFAPQKFKEKTAEQLRVLQASFLNSSVLTDEELNR
LRAQTKLTRREIDAWFTEKNKTKALKDEKVEVDESNVGSSKEEPGENSPGDEAVAPKSAG
TGKICKKTPEQLHMLKSAFVRTQWPSPEEYDKLAEESGLARTDIVSWFGDTRYAWKNGNL
KWYYYYQSSNSSSLNGLSSLRKRGRGRPKGRGRGRPRGRPRGGKRMNTWDRVPSLIKFKT
GTAILKDYYLKHKFLNEQDLDELVNRSHMGYEQVREWFAERQRRSELGIELFEENEEEDE
VIDDQEEDEEETDDSDTWEPPRHVKRKLSKSDD
NT seq 2622 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcagacgaaaatcaacaacaccttgcatggtccttgccagtgagcaggatcca
gatcttgagttgatatcggatttggaagaaggccctcccgtccttacacccgtagaaaat
gctagagcagagagtgtctccagcgatgaagaagttcacgaatctgtggattctgacaat
cagcaaaataagaaagtggaagggggctatgaatgtaaatactgtacttttcaaactcca
gatctaaatatgtttactttccatgtagattcagaacatcccaatgttgtgctgaattca
tcctatgtttgtgttgaatgcaattttcttaccaaaaggtatgatgcactttctgagcat
aatctgaaataccacccaggagaagaaaatttcaaactgactatggtgaagcggaataac
cagacaatctttgaacagacaataaatgatctgacttttgatggcagttttgttaaagag
gagaatacagaacaaggagaatccatagatgtttcttcttcgggaatctccattagtaaa
actcccattatgaaaatgatgaaaaataaggtagaaaacaaacggattacagttcaccat
aactcagctgagggcacttctgaagagaaagagaatggagtaaaagcaagccgggaagaa
aatgcagaaaatacgagttcttcagcttcagaatctaacacaagtacttccactgtcaac
caagtgcatcccagtcctgcaggcacagtggtgacccccacagctgttcttcctgggcta
gcacaggtgataactgcagtctccgctcaacagaactcaaacttggtccctaaggtctta
atccctgttaatagcattccaacctacaatgctgcattggataacaatcctcttctactt
aacacctacaacaaattcccttatcctacaatgtcagaaattacagttctttctgctcaa
gcaaaatatacagaggaacagatcaagatctggttttcagcccaacgtttaaagcatggg
gttagttggactcctgaagaagtagaggaggcaagaagaaaacaattcaatggaacagtg
catactgtacctcagaccataactgttattcctacacacatttccacaggaagtaatggg
ttaccatctattttacaaacatgccaaatagttggtcagccaggtctggtccttactcaa
gtagctggagcaaacaccttgccagtaacggctcccattgctctgacagtggcaggggtt
ccaaatcaaacaaatgtacaaaagagtcaagtgcctgctgctcagcctgctgcagaaaca
aagccagccacagcagcagttccatcatcgccaagtgtcaggcctgaagctgcactagtg
aacccagattcatttggtattcgggccaaaaagactaaggaacagctggcagaactgaaa
gttagctaccttaaaaaccagtttccccacgactcagagatcatcaggcttatgaaaata
acaggccttaccaaaggcgagattaaaaaatggtttagtgatacaaggtacaaccagaga
aattcaaagagtaaccagtgcttacatctcaataacgactcctctgccactatcatcata
gactccagtgatgaaaccccagaacccccagctgcagctgcgtcacagccgaaacagtcc
tggaatccctttcctgactttgctccccagaagtttaaagagaaaactgcagagcaactt
cgtgtccttcaggcaagttttctcaacagttctgtacttacagatgaagaattaaatagg
ttaagagcgcaaaccaaacttactagaagagaaattgatgcttggtttacagagaaaaat
aaaacaaaagctttaaaggatgagaaagtagaagtagatgaaagtaatgtaggtagttcc
aaagaagaacctggagaaaattctcctggagacgaagccgttgcacctaagtcagcaggg
acaggcaagatatgtaagaagacaccagagcaactgcacatgcttaaaagtgcatttgtc
cgaacacagtggccgtcaccagaagagtatgacaagctggctgaagaaagtgggcttgcc
agaacagacatagttagttggtttggagatacccgttatgcttggaagaatgggaacttg
aaatggtactactactatcaaagctccaattcaagtagtttgaatggtctgtcctccctt
aggaaaagagggagaggcagacccaaaggacgaggcagaggcagaccacgtgggcggccc
agaggaggaaaaagaatgaacacctgggacagggtaccgtcgctcataaagtttaaaact
ggaacagcaatacttaaagattattacctgaagcacaaatttcttaatgagcaagacctt
gatgaacttgtcaacagatcacacatgggttacgagcaggtcagagagtggtttgcagaa
agacaaagaagatctgagttaggtatagaattatttgaggaaaatgaggaggaagatgag
gttattgatgatcaggaagaagatgaagaagaaacagatgatagtgacacttgggaaccc
ccacgacatgtgaagcggaagctttctaaatcggatgactga

DBGET integrated database retrieval system