KEGG   Rattus norvegicus (rat): 171287
Entry
171287            CDS       T01003                                 

Gene name
Epha7
Definition
(RefSeq) Eph receptor A7
  KO
K05108  EphA7 [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    171287 (Epha7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    171287 (Epha7)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     171287 (Epha7)
Protein kinases [BR:rno01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   171287 (Epha7)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ephrin_lbd Pkinase fn3 SAM_1 EphA2_TM SAM_2 Pur_ac_phosph_N Ephrin_rec_like PTP_tm DUF2318 Tissue_fac Interfer-bind DUF4998 Y_Y_Y Pkinase_fungal Kdo
Other DBs
NCBI-GeneID: 171287
NCBI-ProteinID: NP_599158
RGD: 70957
Ensembl: ENSRNOG00000007030
UniProt: P54759
Position
5q21
AA seq 998 aa
MVVQTRYPSWIILCYIWLLGFAHTGEAQAAKEVLLLDSKAQQTELEWISSPPSGWEEISG
LDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCK
ETFNLYYYETDYDTGRNIRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKK
GFYLAFQDVGACIALVSVKVYYKKCWSIIENLAVFPDTVTGSEFSSLVEVRGTCVSSAEE
EAENSPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCEPCGRRFYKSSSQDLQCSRCPTHS
FSDREGSSRCECEDGYYRAPSDPPYVACTRPPSAPQNLIFNINQTTVSLEWSPPADNGGR
NDVTYRILCKRCSWEQGECVPCGSNIGYMPQQTGLEDNYVTVMDLLAHANYTFEVEAVNG
VSDLSRSQRLFAAVSITTGQAAPSQVSGVMKERVLQRSVELSWQEPEHPNGVITEYEIKY
YEKDQRERTYSTLKTKSTSASINNLKPGTVYVFQIRAFTAAGYGNYSPRLDVATLEEASG
KMFEATAVSSEQNPVIIIAVVAVAGTIILVFMVFGFIIGRRHCGYSKADQEGDEELYFHF
KFPGTKTYIDPETYEDPNRAVHQFAKELDASCIKIERVIGAGEFGEVCSGRLKLPGKRDV
AVAIKTLKVGYTEKQRRDFLCEASIMGQFDHPNVVHLEGVVTRGKPVMIVIEFMENGALD
AFLRKHDGQFTVIQLVGMLRGIAAGMRYLADMGYVHRDLAARNILVNSNLVCKVSDFGLS
RVIEDDPEAVYTTTGGKIPVRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDM
SNQDVIKAIEEGYRLPAPMDCPAGLHQLMLDCWQKERAERPKFEQIVGILDKMIRNPSSL
KTPLGTCSRPISPLLDQSTPDFTAFCSVGEWLQAIKMERYKDNFTAAGYNSLESVARMTI
DDVMSLGITLVGHQKKIMSSIQTMRAQMLHLHGTGIQV
NT seq 2997 nt   +upstreamnt  +downstreamnt
atggttgttcaaactcggtacccttcgtggattattttgtgttacatctggctgcttggc
tttgcacacacgggggaggcgcaggctgcgaaggaagtactgttactggactcgaaagca
caacaaacagaattggaatggatttcctctccacccagtgggtgggaagaaattagtggt
ttggatgagaactacacaccaataagaacataccaggtgtgccaggtcatggagcccaac
cagaacaactggcttcggactaactggatttctaaaggcaacgcacaaaggatttttgta
gaattgaaattcaccttgagggattgtaatagtcttcccggagtcctgggaacttgcaag
gaaacctttaatttgtactattatgaaacagactacgacaccggcaggaatatacgagaa
aacctttacgttaaaatagacaccattgctgcagatgaaagttttacacaaggtgacctt
ggtgaaagaaagatgaagctgaacactgaggtgagagagattggacctttgtccaaaaag
ggattctatcttgcctttcaggatgtaggggcttgcatagcattggtttctgtcaaagta
tactacaagaagtgctggtccattattgagaacttagctgtctttccagatacagtgact
ggttcagaattttcctccttagttgaggtccgtgggacatgtgtcagcagtgccgaggaa
gaggcagaaaattcacccaggatgcattgcagtgcagaaggagagtggttagtacccatt
ggaaaatgtatctgcaaagcaggctatcagcaaaaaggggacacttgtgaaccctgtggc
cgcaggttctacaaatcttcctctcaggaccttcagtgttctcgttgtccaacccacagt
ttctctgaccgagaaggatcatcgaggtgtgaatgtgaagacgggtactacagagctcct
tctgacccaccatacgtcgcatgcacgaggcctccctctgcaccacagaaccttattttc
aacatcaatcaaacgactgtaagtttggagtggagtcctccagctgacaacggaggaaga
aacgatgtcacctacagaatattgtgtaagcggtgcagctgggagcagggagaatgtgta
ccatgcggaagtaacattggatacatgccccagcagacgggattagaggataactatgtc
actgtcatggacctgcttgcccatgcaaattacacgttcgaagttgaagctgtaaatgga
gtttcagacttaagcagatcccagaggctttttgcagccgttagcatcaccactggtcaa
gcagctccctcgcaagtgagcggagtgatgaaggagagagtgctgcagcggagtgtggag
ctttcctggcaggaaccagaacatcccaacggagtcatcacggaatatgaaatcaagtat
tatgagaaagatcaaagagaaaggacgtactcaacactgaaaaccaagtccacctcagcc
tccattaataatctgaaaccgggaacagtgtatgtttttcagatccgggcgttcactgct
gccggctatggaaattacagccctaggctggatgttgcaacactagaggaagcttcaggt
aaaatgtttgaagcaacagcggtgtccagtgaacagaatcccgtcatcataattgctgtg
gtggctgtagcagggaccatcatcttggtgttcatggtgttcggcttcatcattggaaga
aggcactgtggttacagcaaggctgaccaagaaggggatgaagaactctactttcatttt
aaatttccaggcaccaaaacctacattgaccctgaaacctatgaggacccaaatagagct
gtccatcaattcgccaaggagctagatgcctcctgtattaaaattgagcgtgtgattggt
gcaggagaatttggagaagtttgcagtggtcgtttgaaacttccagggaaaagagatgtt
gcagtggctataaaaaccctgaaagttggttacacagaaaaacaaaggagggacttttta
tgcgaagcaagcatcatggggcaatttgaccacccaaatgtcgtccatttggaaggggtt
gttacaagagggaagcctgtcatgatcgtgatagagttcatggagaacggcgccctggat
gcatttctcaggaaacatgatgggcaatttacagtcattcagttggtaggaatgctgaga
ggaattgcggctggcatgcgctacttggctgacatgggatacgttcacagggaccttgcg
gctcgcaacattcttgtgaacagcaatcttgtttgtaaagtgtccgattttggcctgtcc
cgggttatagaggatgaccccgaagctgtctacacgactactggtggaaaaattccagta
aggtggactgcccctgaagccatccaataccggaaattcacctcagccagtgatgtgtgg
agctatgggattgtcatgtgggaagtaatgtcttatggagaacgaccttattgggacatg
tcgaatcaagatgtcattaaagcgatagaagaaggttatcgcttaccagcacccatggac
tgcccagctggtcttcaccagctaatgctggattgttggcagaaagaacgggcagagagg
ccaaagtttgagcagatagtcggaattctagacaaaatgattcgaaatccaagcagtctg
aaaacacccctgggaacttgtagcagacccataagccctcttctggaccagagcactccc
gacttcactgccttctgttcagtgggagagtggttgcaggctattaaaatggagaggtat
aaagacaacttcacagcggcaggttacaactcactcgagtcggtggcccggatgaccatc
gacgatgtgatgagtttagggatcacactggttggccatcaaaagaagattatgagcagc
atccagactatgcgggcacagatgctgcacttacacggaaccggcatccaagtgtga

DBGET integrated database retrieval system