KEGG   Rattus norvegicus (rat): 171293Help
Entry
171293            CDS       T01003                                 

Gene name
Ctsd
Definition
(RefSeq) cathepsin D
  KO
K01379  cathepsin D [EC:3.4.23.5]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04071  Sphingolipid signaling pathway
rno04140  Autophagy - animal
rno04142  Lysosome
rno04210  Apoptosis
rno04915  Estrogen signaling pathway
rno05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    171293 (Ctsd)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    171293 (Ctsd)
   04140 Autophagy - animal
    171293 (Ctsd)
  09143 Cell growth and death
   04210 Apoptosis
    171293 (Ctsd)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    171293 (Ctsd)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    171293 (Ctsd)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rno01002]
    171293 (Ctsd)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    171293 (Ctsd)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.5  cathepsin D
     171293 (Ctsd)
Peptidases [BR:rno01002]
 Aspartic Peptidases
  Family A1: pepsin family
   171293 (Ctsd)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   171293 (Ctsd)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Asp TAXi_N A1_Propeptide TAXi_C
Motif
Other DBs
NCBI-GeneID: 171293
NCBI-ProteinID: NP_599161
RGD: 621511
Ensembl: ENSRNOG00000020206
UniProt: Q6P6T6
Structure
PDB: 

Position
1q41
AA seq 407 aa AA seqDB search
MQTPGVLLLILGLLAASSSALIRIPLRKFTSIRRTMTEVGGSVEDLILKGPITKYSMQSS
PRTKEPVSELLKNYLDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWVH
HKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCKSDLGGIKVEKQIFGEATKQ
PGVVFIAAKFDGILGMGYPFISVNNVLPVFDNLMKQKLVEKNIFSFYLNRDPTGQPGGEL
MLGGTDSRYYHGELSYLNVTRKAYWQVHMDQLEVGSELTLCKGGCEAIVDTGTSLLVGPV
DEVKELQKAIGAVPLIQGEYMIPCEKVSSLPIITFKLGGQNYELHPEKYILKVSQAGKTI
CLSGFMGMDIPPPSGPLWILGDVFIGCYYTVFDREYNRVGFAKAATL
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgcagacccccggcgtcttgctgctcattctcggcctcctggctgcgtcctcctccgcg
cttatcagaatccccctgcgcaagttcacatccatccgtcggactatgacggaagtggga
ggctctgtggaagacctgatccttaaaggtcccataaccaagtactccatgcagtcatct
cctaggaccaaggagccagtgtcagagttactaaaaaactacctggatgcccagtactat
ggtgagatcggcattgggactcccccacagtgtttcacagtcgtctttgacactggctcc
tctaacctgtgggtcccctccattcattgcaagctgctggacatagcctgctgggtccac
cacaagtacaacagtgacaagtccagcacctatgtgaagaatggcacatccttcgacatc
cactacggctcaggtagcctctctgggtacctgagccaggacactgtgtcggttccatgt
aagtcagacttaggaggtatcaaggtggagaaacagatctttggggaagccaccaagcag
cctggagtcgtattcatcgcagccaagtttgatggcatcttgggcatgggctaccctttt
atctctgttaacaatgtgctcccggtcttcgacaacctgatgaaacagaagctggtggaa
aagaacatcttctccttctacctgaacagggacccaaccgggcaacctggaggagaacta
atgcttggcggcactgactccagatactaccacggggagctgtcctacctgaacgtcacc
cgaaaggcctactggcaggtgcacatggaccagctggaggtgggcagcgagctgactctg
tgcaagggaggctgtgaggctattgtggacacagggacgtctcttctggtggggcctgtg
gacgaggtgaaggaactacagaaggccattggggcagtgcctctcatccagggcgagtat
atgatcccttgtgagaaggtgtccagcctgcccattatcacctttaagctaggaggccaa
aactatgaactacacccagagaagtacatactcaaggtatcgcaggctggaaagacgatc
tgcctgagtggcttcatggggatggacataccccctcccagtgggccgctctggatcctg
ggcgatgtctttattggctgctactacaccgtgtttgacagagaatacaatagggtcggc
tttgccaaggctgccacactctaa

DBGET integrated database retrieval system