KEGG   Rattus norvegicus (rat): 171293
Entry
171293            CDS       T01003                                 

Gene name
Ctsd
Definition
(RefSeq) cathepsin D precursor
  KO
K01379  cathepsin D [EC:3.4.23.5]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04071  Sphingolipid signaling pathway
rno04140  Autophagy - animal
rno04142  Lysosome
rno04210  Apoptosis
rno04915  Estrogen signaling pathway
rno05152  Tuberculosis
rno05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    171293 (Ctsd)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    171293 (Ctsd)
   04140 Autophagy - animal
    171293 (Ctsd)
  09143 Cell growth and death
   04210 Apoptosis
    171293 (Ctsd)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    171293 (Ctsd)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    171293 (Ctsd)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    171293 (Ctsd)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    171293 (Ctsd)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    171293 (Ctsd)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.5  cathepsin D
     171293 (Ctsd)
Peptidases and inhibitors [BR:rno01002]
 Aspartic peptidases
  Family A1: pepsin family
   171293 (Ctsd)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   171293 (Ctsd)
SSDB
Motif
Pfam: Asp TAXi_N A1_Propeptide TAXi_C
Other DBs
NCBI-GeneID: 171293
NCBI-ProteinID: NP_599161
RGD: 621511
Ensembl: ENSRNOG00000020206
UniProt: Q6P6T6
Structure
PDB: 
5UX4

Position
1
AA seq 407 aa
MQTPGVLLLILGLLAASSSALIRIPLRKFTSIRRTMTEVGGSVEDLILKGPITKYSMQSS
PRTKEPVSELLKNYLDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWVH
HKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCKSDLGGIKVEKQIFGEATKQ
PGVVFIAAKFDGILGMGYPFISVNNVLPVFDNLMKQKLVEKNIFSFYLNRDPTGQPGGEL
MLGGTDSRYYHGELSYLNVTRKAYWQVHMDQLEVGSELTLCKGGCEAIVDTGTSLLVGPV
DEVKELQKAIGAVPLIQGEYMIPCEKVSSLPIITFKLGGQNYELHPEKYILKVSQAGKTI
CLSGFMGMDIPPPSGPLWILGDVFIGCYYTVFDREYNRVGFAKAATL
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgcagacccccggcgtcttgctgctcattctcggcctcctggctgcgtcctcctccgcg
cttatcagaatccccctgcgcaagttcacatccatccgtcggactatgacggaagtggga
ggctctgtggaagacctgatccttaaaggtcccataaccaagtactccatgcagtcatct
cctaggaccaaggagccagtgtcagagttactaaaaaactacctggatgcccagtactat
ggtgagatcggcattgggactcccccacagtgtttcacagtcgtctttgacactggctcc
tctaacctgtgggtcccctccattcattgcaagctgctggacatagcctgctgggtccac
cacaagtacaacagtgacaagtccagcacctatgtgaagaatggcacatccttcgacatc
cactacggctcaggtagcctctctgggtacctgagccaggacactgtgtcggttccatgt
aagtcagacttaggaggtatcaaggtggagaaacagatctttggggaagccaccaagcag
cctggagtcgtattcatcgcagccaagtttgatggcatcttgggcatgggctaccctttt
atctctgttaacaatgtgctcccggtcttcgacaacctgatgaaacagaagctggtggaa
aagaacatcttctccttctacctgaacagggacccaaccgggcaacctggaggagaacta
atgcttggcggcactgactccagatactaccacggggagctgtcctacctgaacgtcacc
cgaaaggcctactggcaggtgcacatggaccagctggaggtgggcagcgagctgactctg
tgcaagggaggctgtgaggctattgtggacacagggacgtctcttctggtggggcctgtg
gacgaggtgaaggaactacagaaggccattggggcagtgcctctcatccagggcgagtat
atgatcccttgtgagaaggtgtccagcctgcccattatcacctttaagctaggaggccaa
aactatgaactacacccagagaagtacatactcaaggtatcgcaggctggaaagacgatc
tgcctgagtggcttcatggggatggacataccccctcccagtgggccgctctggatcctg
ggcgatgtctttattggctgctactacaccgtgtttgacagagaatacaatagggtcggc
tttgccaaggctgccacactctaa

KEGG   Rattus norvegicus (rat): 252929
Entry
252929            CDS       T01003                                 

Gene name
Ctsz
Definition
(RefSeq) cathepsin Z precursor
  KO
K08568  cathepsin X [EC:3.4.18.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
rno04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    252929 (Ctsz)
  09143 Cell growth and death
   04210 Apoptosis
    252929 (Ctsz)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    252929 (Ctsz)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.18  Cysteine-type carboxypeptidases
    3.4.18.1  cathepsin X
     252929 (Ctsz)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C1: papain family
   252929 (Ctsz)
SSDB
Motif
Pfam: Peptidase_C1 Peptidase_C1_2
Other DBs
NCBI-GeneID: 252929
NCBI-ProteinID: NP_899159
RGD: 708479
Ensembl: ENSRNOG00000050697
UniProt: Q9R1T3
Position
3
AA seq 306 aa
MASSGSVQQLRLVLLMLLLAGAARASLYFRPGQTCYRPLHRDHLALLGRRTYPRPHEYLS
PADLPKNWDWRNVNGVNYASVTRNQHIPQYCGSCWAHGSTSALADRINIKRKGAWPSTLL
SVQNVIDCGNAGSCEGGNDLPVWEYAHKHGIPDETCNNYQAKDQECDKFNQCGTCTEFKE
CHTIQNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATERMSNYTGGIYTEYQNQAI
INHIISVAGWGVSNDGIEYWIVRNSWGEPWGERGWMRIVTSTYKGGTGSSYNLAIEEACT
FGDPIV
NT seq 921 nt   +upstreamnt  +downstreamnt
atggcgtcgtcgggatcggtgcagcagctgcggctggtgctgctgatgttgctgctggcc
ggtgcggcacgggccagcctctacttccgcccgggccagacctgctaccgaccccttcac
agggaccacctggctctgctggggcgcaggacctatcctcggccacatgagtacctgtcc
ccagcggatctccccaagaactgggactggaggaatgtgaacggtgtcaactatgccagc
gtcacgaggaatcagcatatcccacagtactgtggttcttgctgggcccacggcagcacc
agtgccttggcagatcgcatcaacatcaagagaaaaggtgcatggccctccaccctgttg
tcggtgcagaatgtcatcgactgcggcaatgctggttcttgtgaggggggcaatgacctt
ccggtgtgggagtatgcccacaagcatggcatccccgatgagacctgcaacaactaccag
gccaaggaccaagaatgtgacaagtttaaccagtgtgggacctgcactgaattcaaagag
tgccacaccatccagaattataccctctggagagtgggtgactatggctccctgtccggg
agggagaagatgatggcagagatctacgccaatggtcccatcagctgcgggataatggca
accgagaggatgtctaactacactggaggcatctatactgagtaccagaaccaggccatt
atcaaccacatcatctctgtagccggctggggtgtcagcaatgatggcatcgagtattgg
attgtccgcaattcatggggcgagccctggggtgagcgaggctggatgagaattgtgacc
agcacctataagggagggacaggttccagctacaacctcgccattgaggaggcctgcaca
tttggggaccccattgtctag

KEGG   Rattus norvegicus (rat): 25423
Entry
25423             CDS       T01003                                 

Gene name
Ctsc
Definition
(RefSeq) dipeptidyl peptidase 1 precursor
  KO
K01275  cathepsin C [EC:3.4.14.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
rno04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    25423 (Ctsc)
  09143 Cell growth and death
   04210 Apoptosis
    25423 (Ctsc)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    25423 (Ctsc)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    25423 (Ctsc)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25423 (Ctsc)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.1  dipeptidyl-peptidase I
     25423 (Ctsc)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C1: papain family
   25423 (Ctsc)
Chaperones and folding catalysts [BR:rno03110]
 Intramolecular chaperones
  Papain family
   25423 (Ctsc)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   25423 (Ctsc)
SSDB
Motif
Pfam: Peptidase_C1 CathepsinC_exc Peptidase_C1_2 Pox_I6 Propeptide_C1
Other DBs
NCBI-GeneID: 25423
NCBI-ProteinID: NP_058793
RGD: 2445
Ensembl: ENSRNOG00000016496
UniProt: P80067
Structure
PDB: 
1JQP

Position
1
AA seq 462 aa
MGPWTHSLRAALLLVLLGVCTVSSDTPANCTYPDLLGTWVFQVGPRHPRSHINCSVMEPT
EEKVVIHLKKLDTAYDEVGNSGYFTLIYNQGFEIVLNDYKWFAFFKYEVKGSRAISYCHE
TMTGWVHDVLGRNWACFVGKKMANHSEKVYVNVAHLGGLQEKYSERLYSHNHNFVKAINS
VQKSWTATTYEEYEKLSIRDLIRRSGHSGRILRPKPAPITDEIQQQILSLPESWDWRNVR
GINFVSPVRNQESCGSCYSFASLGMLEARIRILTNNSQTPILSPQEVVSCSPYAQGCDGG
FPYLIAGKYAQDFGVVEENCFPYTATDAPCKPKENCLRYYSSEYYYVGGFYGGCNEALMK
LELVKHGPMAVAFEVHDDFLHYHSGIYHHTGLSDPFNPFELTNHAVLLVGYGKDPVTGLD
YWIVKNSWGSQWGESGYFRIRRGTDECAIESIAMAAIPIPKL
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgggtccgtggacccactccttgcgcgccgccctgctgctggtgcttttgggagtctgc
accgtgagctccgacactcctgccaactgcacttaccctgacctgctgggtacctgggtt
ttccaggtgggccctagacatccccgaagtcacattaactgctcggtaatggaaccaaca
gaagaaaaggtagtgatacacctgaagaagttggatactgcctatgatgaagtgggcaat
tctgggtatttcaccctcatttacaaccaaggctttgagattgtgttgaatgactacaag
tggtttgcgtttttcaagtatgaagtcaaaggcagcagagccatcagttactgccatgag
accatgacagggtgggtccatgatgtcctgggccggaactgggcttgctttgttggcaag
aagatggcaaatcactctgagaaggtttatgtgaatgtggcacaccttggaggtctccag
gaaaaatattctgaaaggctctacagtcacaaccacaactttgtgaaggccatcaattct
gttcagaagtcttggactgcaaccacctatgaagaatatgagaaactgagcatacgagat
ttgataaggagaagtggccacagcggaaggatcctaaggcccaaacctgccccgataact
gatgaaatacagcaacaaattttaagtttgccagaatcttgggactggagaaacgtccgt
ggcatcaattttgttagccctgttcgaaaccaagaatcttgtggaagctgctactcattt
gcctctctgggtatgctagaagcaagaattcgtatattaaccaacaattctcagacccca
atcctgagtcctcaggaggttgtatcttgtagcccgtatgcccaaggttgtgatggtgga
ttcccatacctcattgcaggaaagtatgcccaagattttggggtggtggaagaaaactgc
tttccctacacagccacagatgctccatgcaaaccaaaggaaaactgcctccgttactat
tcttctgagtactactatgtgggtggtttctatggtggctgcaatgaagccctgatgaag
cttgagctggtcaaacacggacccatggcagttgcctttgaagtccacgatgacttcctg
cactaccacagtgggatctaccaccacactggactgagcgaccctttcaacccctttgag
ctgaccaatcatgctgttctgcttgtgggctatggaaaagatccagtcactgggttagac
tactggattgtcaagaacagctggggctctcaatggggtgagagtggctacttccggatc
cgcagaggaactgatgaatgtgcaattgagagtatagccatggcagccataccgattcct
aaattgtag

KEGG   Rattus norvegicus (rat): 25424
Entry
25424             CDS       T01003                                 

Gene name
Ctse
Definition
(RefSeq) cathepsin E precursor
  KO
K01382  cathepsin E [EC:3.4.23.34]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    25424 (Ctse)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    25424 (Ctse)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.34  cathepsin E
     25424 (Ctse)
Peptidases and inhibitors [BR:rno01002]
 Aspartic peptidases
  Family A1: pepsin family
   25424 (Ctse)
SSDB
Motif
Pfam: Asp TAXi_N A1_Propeptide
Other DBs
NCBI-GeneID: 25424
NCBI-ProteinID: NP_037070
RGD: 2446
Ensembl: ENSRNOG00000006963
UniProt: P16228
Position
13
AA seq 365 aa
MKPLFVLLLLLLLLDLAQAQGVLHRVPLRRHQSLRKKLRAQGQLSDFWRSHNLDMIEFSE
SCNVDKGINEPLINYLDMEYFGTVSIGSPSQNFTVIFDTGSSNLWVPSVYCTSSACKAHP
VFHPSQSSTYMEVGNHFSIQYGTGSLTGIIGADQVSVEGLTVEGQQFGESVKEPGQTFVN
AEFDGILGLGYPSLAVGGVTPVFDNMMAQNLVALPMFSVYLSSDPQGGSGSELTFGGYDP
SHFSGSLNWIPVTKQGYWQIALDGIQVGDTVMFCSEGCQAIVDTGTSLITGPPKKIKQLQ
EAIGATPMDGEDLVDGMQFCGSGFQGLDIQPPAGPLWILGDVFIRKFYSVFDRGNNQVGL
APAVP
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgaaacctctcttcgtgctgctgctgctgctgctgctcctggacctggcacaggcccaa
ggggtgctgcacagggtgcccctcagaagacatcagtccctccggaagaaactacgggcc
caaggccagctctcagacttctggagatctcataacttggacatgatcgaattcagcgag
tcctgtaatgtggataagggtatcaatgagcccctcatcaactacctggatatggaatac
tttggcaccgtctccatcggctccccatcgcagaacttcaccgtcatctttgacacgggc
tcatccaacctctgggtcccttctgtgtactgcaccagctcagcatgcaaggcacacccg
gtgttccacccatcgcagtccagcacctacatggaggtagggaatcacttctccatccag
tatggtactgggagcctgacaggaatcattggagctgaccaagtctctgtggaagggttg
actgtggaaggccagcaatttggagaaagtgtcaaggagcctggtcagacctttgtgaat
gcggagtttgacgggattctgggcctgggatacccctcattggctgttggaggagtgacc
ccagtgtttgataacatgatggcccagaaccttgtggctctgcctatgttttctgtctac
ttgagcagtgacccacaaggtggctcaggcagtgaactgactttcggaggctatgacccc
tctcatttctctgggagcctcaattggatcccagtcaccaagcaaggctactggcagatt
gccctggatggaatccaggtgggagacactgtgatgttctgctctgagggctgccaggcc
atagtggacacagggacctccctcatcactggcccccccaagaagatcaaacagcttcaa
gaggccattggggccacacccatggatggagaagacttggtggatggaatgcagttctgc
ggcagtggctttcaaggacttgacattcaacctccggctggacccctctggatcctgggg
gatgtcttcatccgaaagttttactcagtctttgatcgtggaaataaccaagtgggattg
gcccccgcagtcccttaa

KEGG   Rattus norvegicus (rat): 25425
Entry
25425             CDS       T01003                                 

Gene name
Ctsh
Definition
(RefSeq) pro-cathepsin H precursor
  KO
K01366  cathepsin H [EC:3.4.22.16]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
rno04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    25425 (Ctsh)
  09143 Cell growth and death
   04210 Apoptosis
    25425 (Ctsh)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    25425 (Ctsh)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.16  cathepsin H
     25425 (Ctsh)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C1: papain family
   25425 (Ctsh)
SSDB
Motif
Pfam: Peptidase_C1 Inhibitor_I29 Peptidase_C1_2
Other DBs
NCBI-GeneID: 25425
NCBI-ProteinID: NP_037071
RGD: 2447
Ensembl: ENSRNOG00000014064
UniProt: P00786
Position
8
AA seq 333 aa
MWTALPLLCAGAWLLSAGATAELTVNAIEKFHFTSWMKQHQKTYSSREYSHRLQVFANNW
RKIQAHNQRNHTFKMGLNQFSDMSFAEIKHKYLWSEPQNCSATKSNYLRGTGPYPSSMDW
RKKGNVVSPVKNQGACGSCWTFSTTGALESAVAIASGKMMTLAEQQLVDCAQNFNNHGCQ
GGLPSQAFEYILYNKGIMGEDSYPYIGKNGQCKFNPEKAVAFVKNVVNITLNDEAAMVEA
VALYNPVSFAFEVTEDFMMYKSGVYSSNSCHKTPDKVNHAVLAVGYGEQNGLLYWIVKNS
WGSNWGNNGYFLIERGKNMCGLAACASYPIPQV
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgtggactgcgctgcccctgctgtgcgctggggcctggctgctgagtgctggggccacc
gctgagctgaccgtgaatgccatagaaaagtttcactttacgtcatggatgaaacagcat
caaaagacgtacagctcgagggagtacagccacaggctgcaggtgtttgccaacaactgg
aggaagattcaagcccacaaccagaggaaccacacatttaaaatgggattgaaccagttt
tcagatatgagctttgccgaaataaaacacaaatacctctggtcagagcctcagaattgc
tcagccaccaaaagtaactacctccgtggtactggcccctacccatcctccatggactgg
aggaagaaaggaaatgtcgtttcaccagtgaagaaccagggggcctgtggcagctgctgg
actttctcaaccactggggccctagagtcagctgtggctattgccagtgggaaaatgatg
accttggctgagcagcagctggtggattgtgcccagaacttcaacaatcatggctgccaa
ggaggtctccccagccaggccttcgagtacatcctgtacaacaagggcatcatgggagag
gacagctacccttacataggcaagaatggtcagtgcaaattcaacccagaaaaggccgtc
gcgttcgtcaagaatgttgtcaacatcacactcaatgatgaggctgcaatggtagaggct
gtggccctatacaatcctgtgagctttgcctttgaggtgactgaagattttatgatgtat
aaaagtggtgtctactccagtaactcctgtcataaaactccagataaagtaaaccatgca
gtcctggctgttggctatggagaacagaatggattactctactggattgtgaaaaactct
tggggctccaactgggggaacaatgggtacttcctcattgagcgtggaaagaacatgtgt
ggcctggctgcctgtgcctcctaccccatccctcaggtataa

KEGG   Rattus norvegicus (rat): 25697
Entry
25697             CDS       T01003                                 

Gene name
Ctsl
Definition
(RefSeq) procathepsin L preproprotein
  KO
K01365  cathepsin L [EC:3.4.22.15]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04140  Autophagy - animal
rno04142  Lysosome
rno04145  Phagosome
rno04210  Apoptosis
rno04612  Antigen processing and presentation
rno05205  Proteoglycans in cancer
rno05323  Rheumatoid arthritis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    25697 (Ctsl)
   04142 Lysosome
    25697 (Ctsl)
   04140 Autophagy - animal
    25697 (Ctsl)
  09143 Cell growth and death
   04210 Apoptosis
    25697 (Ctsl)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    25697 (Ctsl)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    25697 (Ctsl)
  09163 Immune disease
   05323 Rheumatoid arthritis
    25697 (Ctsl)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    25697 (Ctsl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    25697 (Ctsl)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    25697 (Ctsl)
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    25697 (Ctsl)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.15  cathepsin L
     25697 (Ctsl)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C1: papain family
   25697 (Ctsl)
Chaperones and folding catalysts [BR:rno03110]
 Intramolecular chaperones
  Papain family
   25697 (Ctsl)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Others
  25697 (Ctsl)
SSDB
Motif
Pfam: Peptidase_C1 Inhibitor_I29 Peptidase_C1_2
Other DBs
NCBI-GeneID: 25697
NCBI-ProteinID: NP_037288
RGD: 2448
Ensembl: ENSRNOG00000018566
UniProt: P07154
Position
17
AA seq 334 aa
MTPLLLLAVLCLGTALATPKFDQTFNAQWHQWKSTHRRLYGTNEEEWRRAVWEKNMRMIQ
LHNGEYSNGKHGFTMEMNAFGDMTNEEFRQIVNGYRHQKHKKGRLFQEPLMLQIPKTVDW
REKGCVTPVKNQGQCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHDQGNQGCNG
GLMDFAFQYIKENGGLDSEESYPYEAKDGSCKYRAEYAVANDTGFVDIPQQEKALMKPVA
TVGPISVAMDASHPSLQFYSSGIYYEPNCSSKDLDHGVLVVGYGYEGTDSNKDKYWLVKN
SWGKEWGMDGYIKIAKDRNNHCGLATAASYPIVN
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgacccctttactcctcctggctgtcctctgcttgggaacagccttagccactccaaaa
tttgatcaaacgtttaatgcacagtggcaccagtggaagtccacacacagaagactgtat
ggcacgaatgaggaagagtggaggagagcagtgtgggagaagaacatgaggatgatccag
ctacacaatggggagtacagcaacgggaagcacggctttaccatggagatgaacgccttc
ggtgacatgaccaatgaggaattcaggcagatagtgaatggctatcgccaccagaagcac
aagaagggaaggttatttcaggaacctctgatgctgcagatccccaagactgtggactgg
agagaaaagggttgtgtgactcctgtgaagaatcagggccagtgtggttcttgctgggct
tttagcgcatcgggttgcctagaaggacagatgttccttaagactggcaaactgatctca
ctgagtgaacagaaccttgtggactgttctcacgatcaaggcaatcagggctgtaatgga
ggcctgatggattttgctttccagtacattaaggaaaatggaggtctggactcagaggag
tcttatccctatgaagcaaaggatggatcttgtaaatacagagctgagtatgctgtggct
aacgacacagggtttgtggatatccctcagcaagagaaagccctcatgaagcctgtagcg
acggtggggcctatttctgttgccatggatgcaagccatccgtctctccagttctatagt
tcaggtatctactatgaacccaactgtagcagcaaggacctcgaccatggggttctggtg
gttggctatggttatgaaggaacagattcaaataaggataaatactggcttgtcaaaaac
agctggggtaaagaatggggtatggatggctacatcaaaatagccaaagaccggaacaac
cactgcggacttgccaccgcagccagctatcctatcgtgaattga

KEGG   Rattus norvegicus (rat): 290257
Entry
290257            CDS       T01003                                 

Gene name
Ctsg
Definition
(RefSeq) cathepsin G precursor
  KO
K01319  cathepsin G [EC:3.4.21.20]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04142  Lysosome
rno04613  Neutrophil extracellular trap formation
rno04614  Renin-angiotensin system
rno05146  Amoebiasis
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    290257 (Ctsg)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    290257 (Ctsg)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    290257 (Ctsg)
  09152 Endocrine system
   04614 Renin-angiotensin system
    290257 (Ctsg)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    290257 (Ctsg)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    290257 (Ctsg)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    290257 (Ctsg)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    290257 (Ctsg)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.20  cathepsin G
     290257 (Ctsg)
Peptidases and inhibitors [BR:rno01002]
 Serine peptidases
  Family S1: chymotrypsin family
   290257 (Ctsg)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Others
   290257 (Ctsg)
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986 zf-RING_13
Other DBs
NCBI-GeneID: 290257
NCBI-ProteinID: NP_001099511
RGD: 1307681
Ensembl: ENSRNOG00000020647
UniProt: G3V9Q7
Position
15
AA seq 250 aa
MQPLLFLLIFVLFQEDEAGKIIGGREARPNSHPYMAFLLIQSPEGLSACGGFLVREDFVL
TAGHCFGSSINVTLGAHNIRRQEGTQQHITVLRAIRHPDYNPPPVIQNDIMLLQLRSRAR
RSRAVKPVALPQATKRVQPGALCTVAGWGLVSQRRGTNVLQEVKLRVQTDQTCANRFQFY
NSQTQICVGNPRERKSAFKGDSGGPLVCNNVAQGIVSYGSSSGNPPAVFTRIQSFMPWIK
RTMRRLSSRY
NT seq 753 nt   +upstreamnt  +downstreamnt
atgcagccactcctgtttctgttgatctttgttctattccaagaagatgaggcaggaaag
atcattggaggccgagaagccaggccaaattcccacccctacatggcatttcttctgatc
cagagtccagaagggctgagtgcttgtggagggtttctggtgcgagaagactttgtcctc
acagcaggtcactgctttggaagctccataaatgttaccctaggggcccacaacattcga
aggcaagaagggacccagcaacacatcactgttctcagagccatccgccatcctgattac
aatcccccgccagtcatccagaatgacatcatgctactgcagctgaggagtagagcccgg
aggagtcgagcggtgaagcccgtggctctgcctcaagccaccaagagagtacaaccaggg
gctttgtgcacagtggctggctggggcctggtgagccagcgcagggggacaaatgtactc
caggaggtgaagctaagagtgcagacggaccaaacgtgcgccaatcgtttccaattctac
aacagccagactcagatctgtgtgggaaacccgagagaaaggaagtctgccttcaagggt
gattctggtggtcctctggtatgtaataatgtggcccagggcatcgtctcctatggaagc
agcagtggtaaccctccagctgtgttcaccagaatccagagcttcatgccctggatcaaa
agaacaatgagacgtctttcctcaaggtattag

KEGG   Rattus norvegicus (rat): 29174
Entry
29174             CDS       T01003                                 

Gene name
Ctsj
Definition
(RefSeq) cathepsin J precursor
  KO
K09599  cathepsin P [EC:3.4.22.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    29174 (Ctsj)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    29174 (Ctsj)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     29174 (Ctsj)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C1: papain family
   29174 (Ctsj)
SSDB
Motif
Pfam: Peptidase_C1 Inhibitor_I29 Peptidase_C1_2
Other DBs
NCBI-GeneID: 29174
NCBI-ProteinID: NP_058817
RGD: 69241
Ensembl: ENSRNOG00000046476
UniProt: Q63088
Position
17
AA seq 334 aa
MTPAVFLVILCFGVASGAPARDPNLDAEWQDWKTKYAKSYSPVEEELKRAVWEENLKMIQ
LHNKENGLGKNGFTMEMNAFADTTGEEFRKSLSDILIPAAVTNPSAQKQVSIGLPNFKDW
RKEGYVTPVRNQGKCGSCWAFAAVGAIEGQMFSKTGNLTPLSVQNLLDCSKSEGNNGCRW
GTAHQAFNYVLKNKGLEAEATYPYEGKDGPCRYHSENASANITGFVNLPPNELYLWVAVA
SIGPVSAAIDASHDSFRFYSGGVYHEPNCSSYVVNHAVLVVGYGFEGNETDGNNYWLIKN
SWGEEWGINGFMKIAKDRNNHCGIASQASFPDIF
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgacgcctgctgtctttctggtgatcctgtgctttggagtggcctcaggtgccccagca
cgtgatcccaatttggatgctgaatggcaagactggaagactaaatatgcaaaatcatat
agcccggtggaagaagaactgaagagggcagtatgggaagaaaacttgaaaatgatccaa
ctgcacaacaaggagaatggcctggggaagaatggcttcactatggaaatgaatgccttt
gctgatacaactggtgaagaattcagaaaatcattgagtgatattctaattccggctgct
gtgacaaacccaagtgcccagaaacaagtctctattggtttacccaactttaaggattgg
agaaaggaaggctatgtgactcctgtacggaatcagggtaaatgcggctcttgttgggct
tttgctgcagttggtgcgatagaaggtcagatgttctcaaaaactggcaacctcacccct
ctaagtgtgcagaatctattggactgttctaaaagtgaaggaaataatggctgccgttgg
ggtactgcacaccaagcattcaattatgttttgaaaaataaaggtcttgaggctgaggca
acctatccatatgaaggaaaagacggaccctgcaggtaccacagtgagaacgctagtgct
aacatcacaggttttgtgaacctcccaccgaatgagctttacctatgggttgctgtagca
tctattgggcccgtctctgcggcaattgatgcttctcatgactctttcagattctacagt
ggaggtgtttatcatgagccaaattgcagcagttatgttgtgaatcatgcagtgctggtg
gttggctatggatttgagggaaatgaaacagatggcaataactactggctgatcaagaac
agttggggtgaagaatggggcattaatggcttcatgaagatagccaaagatcgcaacaac
cactgtggaattgcttcacaagccagcttccccgatatattctga

KEGG   Rattus norvegicus (rat): 29175
Entry
29175             CDS       T01003                                 

Gene name
Ctsk
Definition
(RefSeq) cathepsin K precursor
  KO
K01371  cathepsin K [EC:3.4.22.38]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
rno04210  Apoptosis
rno04380  Osteoclast differentiation
rno04620  Toll-like receptor signaling pathway
rno05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    29175 (Ctsk)
  09143 Cell growth and death
   04210 Apoptosis
    29175 (Ctsk)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    29175 (Ctsk)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    29175 (Ctsk)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    29175 (Ctsk)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    29175 (Ctsk)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    29175 (Ctsk)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.38  cathepsin K
     29175 (Ctsk)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C1: papain family
   29175 (Ctsk)
Chaperones and folding catalysts [BR:rno03110]
 Intramolecular chaperones
  Papain family
   29175 (Ctsk)
SSDB
Motif
Pfam: Peptidase_C1 Inhibitor_I29 Peptidase_C1_2
Other DBs
NCBI-GeneID: 29175
NCBI-ProteinID: NP_113748
RGD: 61810
Ensembl: ENSRNOG00000021155
UniProt: O35186
Position
2
AA seq 329 aa
MWVFKFLLLPVVSFALSPEETLDTQWELWKKTHGKQYNSKVDEISRRLIWEKNLKKISVH
NLEASLGAHTYELAMNHLGDMTSEEVVQKMTGLRVPPSRSFSNDTLYTPEWEGRVPDSID
YRKKGYVTPVKNQGQCGSCWAFSSAGALEGQLKKKTGKLLALSPQNLVDCVSENYGCGGG
YMTTAFQYVQQNGGIDSEDAYPYVGQDESCMYNATAKAAKCRGYREIPVGNEKALKRAVA
RVGPVSVSIDASLTSFQFYSRGVYYDENCDRDNVNHAVLVVGYGTQKGNKYWIIKNSWGE
SWGNKGYVLLARNKNNACGITNLASFPKM
NT seq 990 nt   +upstreamnt  +downstreamnt
atgtgggtgttcaagtttttgctgctacccgtggtgagctttgctctatccccggaggaa
acgctggacacgcagtgggagctgtggaagaagacccacgggaagcagtacaacagcaag
gtggatgaaatctctcggcgtttaatttgggaaaaaaacctgaagaaaatttctgtccat
aatcttgaggcctctcttggtgcccatacgtatgagctggccatgaatcacctgggagac
atgaccagcgaagaagtggttcagaagatgactggactcagagtgccaccttcgcgttcc
ttcagtaatgacactctctataccccagagtgggaaggcagagtcccagactccatcgac
tatcgaaagaaaggctatgttactccagtcaaaaaccagggccagtgtggttcctgttgg
gctttcagctctgcgggtgccctggagggccaactcaagaagaaaactggcaaactctta
gctctgagtccccagaatcttgtggactgtgtgtctgagaactatggctgtggaggcggc
tatatgaccactgccttccaatatgtgcagcagaatggaggcattgactctgaagacgct
tacccgtatgtggggcaggatgaaagttgtatgtataacgccacggcaaaggcagctaag
tgcagagggtacagagagatccctgtggggaacgagaaagccctgaagagagcagtggct
cgggtaggacccgtctctgtgtccatcgatgcaagcttgacatctttccaattttacagc
agaggtgtgtactatgacgaaaactgcgaccgtgataatgtgaaccatgccgtgttggtg
gtgggctatggcacccagaagggaaataagtactggataattaaaaacagctggggagaa
agctggggaaacaaaggctatgttctcttggctcggaataagaacaatgcctgtggcatt
accaacctggccagcttccccaagatgtga

KEGG   Rattus norvegicus (rat): 293676
Entry
293676            CDS       T01003                                 

Gene name
Ctsw
Definition
(RefSeq) cathepsin W precursor
  KO
K08569  cathepsin W [EC:3.4.22.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
rno04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    293676 (Ctsw)
  09143 Cell growth and death
   04210 Apoptosis
    293676 (Ctsw)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    293676 (Ctsw)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     293676 (Ctsw)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C1: papain family
   293676 (Ctsw)
SSDB
Motif
Pfam: Peptidase_C1 Inhibitor_I29 BTB_3
Other DBs
NCBI-GeneID: 293676
NCBI-ProteinID: NP_001019413
RGD: 1309354
Ensembl: ENSRNOG00000027096
UniProt: Q561Q9
Position
1
AA seq 371 aa
MTLTAHLFYFLALLLAGQGLSDSLLTKDAGPRPLELKEVFKLFQIQFNRSYSNPAEYTRR
LGIFAHNLAQAQRLQEEDLGTAEFGQTPFSDLTEEEFGQLYGHQRAPERILNMAKKVKSE
RWGESVPPTCDWRKVKNIISSIKNQGNCRCCWAIAAADNIQTLWRIKTQQFVDVSVQELL
DCDRCGNGCNGGFVWDAYITVLNNSGLASEEDYPFQGHQKPHRCLADKYRKVAWIQDFTM
LSSNEQVIAGYLAIHGPITVTINMKLLQYYQKGVIKATPSTCDPHLVNHSVLLVGFGKEK
GGMQTGTLLSHSRKPRRSTPYWILKNSWGAEWGEKGYFRLYRGNNTCGIAKYPITARVDR
PVKKAPVSCPP
NT seq 1116 nt   +upstreamnt  +downstreamnt
atgacactgacagcccacctcttctactttctggccctgttgttagcaggccaaggcctc
agtgactccctcctcaccaaggatgcaggtccccgaccactggagctgaaagaagtcttc
aagctgttccagatccagttcaaccgaagttactcaaacccagcagagtacactcgccgt
ctgggtatctttgcccacaacctggctcaggcacaacggctacaggaagaagacctgggt
acagctgagtttggacagactccattcagtgacctcacagaggaagagtttggccagtta
tacgggcaccagagggcaccggaaaggatcctcaacatggccaaaaaggtgaagtctgaa
aggtggggggaatctgtgccccctacctgtgactggcgtaaagtaaagaacatcatctca
tcgatcaagaaccagggaaactgcaggtgctgctgggccatagcagcagcagacaacatc
cagactctgtggcgcatcaaaacacaacagtttgtggacgtctctgtgcaggagctgctg
gactgtgaccgctgtggaaatggctgcaatggtggcttcgtgtgggacgcatatataact
gtcctgaataacagtggcctggccagcgaagaggattacccattccaggggcaccagaag
ccccacaggtgtctggcggacaagtataggaaggtggcctggatccaggacttcaccatg
ttgtccagtaatgagcaggtaattgccggctacctggctatccatggccctatcacggtg
accatcaacatgaagctactgcagtattaccagaagggtgtgatcaaggctacacccagt
acctgtgacccacaccttgtgaaccattctgtcttgctggtgggttttggcaaggagaaa
gggggcatgcagacagggacactcttgtcccattctcgcaaacctcgccgctccaccccc
tactggatcctgaagaactcctggggagctgagtggggcgagaagggttacttcaggctc
taccgtgggaacaacacctgtggaatcgccaagtacccgatcacagctcgagtggaccga
ccagttaagaaagccccagtctcttgtccaccttga

KEGG   Rattus norvegicus (rat): 296370
Entry
296370            CDS       T01003                                 

Gene name
Ctsa
Definition
(RefSeq) lysosomal protective protein precursor
  KO
K13289  cathepsin A (carboxypeptidase C) [EC:3.4.16.5]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
rno04614  Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    296370 (Ctsa)
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    296370 (Ctsa)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    296370 (Ctsa)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    296370 (Ctsa)
   04131 Membrane trafficking [BR:rno04131]
    296370 (Ctsa)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    296370 (Ctsa)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.5  carboxypeptidase C
     296370 (Ctsa)
Peptidases and inhibitors [BR:rno01002]
 Serine peptidases
  Family S10
   296370 (Ctsa)
Chaperones and folding catalysts [BR:rno03110]
 Intramolecular chaperones
  Other peptidases
   296370 (Ctsa)
Membrane trafficking [BR:rno04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Other CMA associated proteins
    296370 (Ctsa)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   296370 (Ctsa)
SSDB
Motif
Pfam: Peptidase_S10
Other DBs
NCBI-GeneID: 296370
NCBI-ProteinID: NP_001011959
RGD: 1309070
Position
3
AA seq 493 aa
MTSSPKAAPGEQGHKEAEMPRAALSPLLLLLLLSWASRDEAAPDQDEIDCLPGLAKQPSF
RQYSGYLKASDSKHFHYWFVESQNDPKNSPVVLWLNGGPGCSSLDGLLTEHGPFLIQPDG
VTLEYNPYSWNLIANMLYIESPAGVGFSYSDDKMYVTNDTEVAENNYQALKDFYHLFPEY
KDNKLFLTGESYAGIYIPTLAVLVMQDPSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGL
LGNRLWTSLQTHCCSQNKCNFYDNKDPDCVNNLQEVSRIVGKSGLNIYNLYAPCAGGVPG
RDRSEDTLVVQDFGNIFTRLPLKRRFPEALLLRSGDKVRLDPPCTNTTAPSTYLNNPYVR
KALHIPESLPRWDMCNLMVNLQYRRLYESMNSQYLKLLSSQKYQILLYNGDVDMACNFMG
DEWFVDSLNQKMEVQRRPWLVDYGESGEQVAGFVKECSHITFLTIKGAGHMVPTDKPRAA
FTMFSRFLNKEPY
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgacttccagtccaaaggcggctccaggagagcaaggacacaaggaagcagagatgccc
cgagcagcactgtctccactgctcctgctgctgctcctatcctgggcgtcccgggacgaa
gcagctccggaccaggatgaaatcgattgcctcccgggcctggccaagcagccctctttc
cggcagtactccggctatctcaaagcatcggattccaagcacttccactactggtttgtg
gaatcgcagaacgaccctaagaacagccccgtggtgctttggctcaatgggggtcctggc
tgcagctccctagatgggttacttacagagcacggtcccttcctgatccagccagatggt
gtcaccctggagtacaacccctattcttggaacctgattgccaacatgctgtatatcgag
tccccagctggggtgggcttctcctactcggatgacaagatgtatgtgaccaatgacaca
gaggtggctgagaacaattatcaagcccttaaagacttctaccacctctttccggagtac
aaggacaacaaacttttcctgaccggagagagctatgctggcatctacatccccaccttg
gctgtactggtcatgcaggatcccagcatgaaccttcaggggctggctgtgggcaatgga
ctctcctcctatgagcagaatgacaactccctggtctactttgcctactaccatggtctt
ctggggaacaggctttggacttcactccagacccactgctgttctcagaacaagtgtaac
ttctatgacaacaaagatccagattgtgtaaacaatctccaggaagtgtctcgaattgtg
ggcaaatctggcctcaacatatacaatctctacgccccgtgtgctggtggggtacccggc
cgtgataggtctgaggacacacttgtagtccaggattttggcaatatcttcactcgcttg
ccactcaagaggagatttcctgaggctctactgcttcggtctggggacaaggtacgcttg
gatcctccatgcaccaacaccacagccccctccacctacctcaacaacccatatgttcgg
aaggctctccacatcccggagtcgctgccccgctgggacatgtgcaacctcatggtgaac
ttacagtaccgccgtctctacgaaagcatgaactcccagtacctgaagttgctcagctca
cagaaataccagatcctgctttacaatggcgatgtggacatggcctgcaacttcatgggg
gatgagtggtttgtggattccctcaaccagaagatggaggtgcagcgccggccctggcta
gtggactacggggagagtggagagcaggtagctggctttgtgaaggaatgctcacacatt
accttcctcaccatcaagggtgccggacacatggtccccacggacaagcctcgagctgct
tttaccatgttctctcgattcctgaacaaggagccttactga

KEGG   Rattus norvegicus (rat): 306720
Entry
306720            CDS       T01003                                 

Gene name
Ctsm
Definition
(RefSeq) cathepsin M precursor
  KO
K09600  cathepsin M [EC:3.4.22.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    306720 (Ctsm)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    306720 (Ctsm)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     306720 (Ctsm)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C1: papain family
   306720 (Ctsm)
SSDB
Motif
Pfam: Peptidase_C1 Inhibitor_I29 Peptidase_C1_2 Styelin
Other DBs
NCBI-GeneID: 306720
NCBI-ProteinID: NP_852043
RGD: 631420
Ensembl: ENSRNOG00000030276
UniProt: Q812B6
Position
17
AA seq 333 aa
MTPAVFLAILCLRLISSSPAPDPVLDAEWQKWKIKYEKTYSLEEEGQKRAVWEENMKKIK
LHNGENGLGKHGFTMEMNAFGDMTIEEFRKLMIEIPIPTVKKENSVQKRQAVNVPNFINW
RKRGYVTPVRRQGRCNVCWAFSVAGAIEGQMFQKTGQLIPLSVQNLVDCSRPQGNLGCYL
GNTYLALQYVKENGGLESEATYPYEEKEGSCRYHPDNSTASITDFEFVPKNEDALMNAVA
TLGPISVAIDARHESFLFYRNGIYHEPNCSSSVVTHAMLLVGYGFVGEESDGRKYWILKN
SMGNKWGNRGYMKIAKDQGNHCGIATYALYPRV
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgactcctgctgtctttctggccatcctgtgcttgagactgatctcatcttcaccagca
cctgatcccgttttggatgctgaatggcagaaatggaaaataaaatatgaaaaaacatac
agcctggaggaagaaggacagaagagagcagtatgggaagaaaatatgaaaaagatcaaa
ctgcacaatggggagaatggcctagggaagcatggtttcactatggaaatgaatgctttt
ggtgacatgacaattgaagaattcaggaaattaatgattgaaatcccaatcccaactgtc
aagaaagagaacagtgtacagaaacgtcaggctgttaacgtgcccaactttataaactgg
aggaagagaggctatgttacccctgtgcggagacagggaagatgtaatgtttgttgggct
ttttctgtggctggtgccatagaaggacagatgttccagaaaacaggtcaactgatccct
ctgagtgtacagaacctggtggactgctctagacctcaaggcaacctgggctgttattta
ggcaatacataccttgcattgcagtatgtgaaggaaaatggaggtctggaatctgaggca
acctatccatatgaagaaaaggaaggatcctgcaggtaccatccagataattctactgct
agtatcacagactttgagtttgtcccaaagaatgaggatgcattaatgaatgctgtggcg
acgctagggcccatttctgttgcgattgatgcaaggcatgaatctttcctgttctataga
aatggtatatatcatgagccaaactgcagtagttctgttgtcacacatgctatgttactg
gttggctatggatttgtaggagaagaatcagatggcaggaagtactggattcttaagaac
agcatgggaaataaatggggcaacagaggctatatgaagattgccaaagaccagggtaac
cactgtggaattgctacatatgccctttatccaagggtgtga

KEGG   Rattus norvegicus (rat): 361704
Entry
361704            CDS       T01003                                 

Gene name
Ctsf
Definition
(RefSeq) cathepsin F precursor
  KO
K01373  cathepsin F [EC:3.4.22.41]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
rno04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    361704 (Ctsf)
  09143 Cell growth and death
   04210 Apoptosis
    361704 (Ctsf)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    361704 (Ctsf)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.41  cathepsin F
     361704 (Ctsf)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C1: papain family
   361704 (Ctsf)
SSDB
Motif
Pfam: Peptidase_C1 Inhibitor_I29 Peptidase_C1_2
Other DBs
NCBI-GeneID: 361704
NCBI-ProteinID: NP_001029282
RGD: 1308181
Ensembl: ENSRNOG00000019708
UniProt: Q499S6
Position
1
AA seq 462 aa
MALLLQLLWLLTLIATVVLSPVPAKPWADDEQAWSLSSQELLAPARFALDMYNYGRTAVT
RAVLGAVHGRVRRAGRGSLFSLEATLEEPPCNDPLVCLHPETKKTMLCSFEVLEELKEHL
LLRKDCSPVNAKVTESGNETFRAFLPMLDKDPLPQDFSVKMATLFKDFMTTYNRTYESRE
EAQWRLTVFARNMIRAQKIQALDRGTAQYGITKFSDLTEEEFHTIYLNPLLQKESGGKMS
LAKSINDLAPPEWDWRKKGAVTEVKDQGMCGSCWAFSVTGNVEGQWFLNRGTLLSLSEQE
LLDCDKMDKACMGGLPSNAYTAIKNLGGLETEDDYGYQGHVQACNFSTQMAKVYINDSVE
LSRDENKIAAWLAQKGPISVAINAFGMQFYRHGIAHPFRPLCSPWFIDHAVLLVGYGNRS
NIPYWAIKNSWGRDWGEEGYYYLYRGSGACGVNTMASSAVVN
NT seq 1389 nt   +upstreamnt  +downstreamnt
atggcgctcctgctgcagcttttgtggctgttgacgctgatcgcgaccgtggtcctgagc
ccagtccctgccaagccctgggcggatgacgagcaagcctggagcctgtcctcccaggag
ctgctggcgcccgcccgcttcgcgctggacatgtacaattacggccgtactgcggtgaca
agggccgtgctaggggcggtacacgggcgcgtccggcgggccggccggggctctctgttc
tccctggaagccacattagaggagccaccttgcaatgatcccctggtgtgcctgcaccct
gagacgaagaaaacaatgctctgcagttttgaagtcctggaagagctaaaagaacacttg
ctgctgaggaaggactgtagcccagtgaatgccaaggttacagagtctgggaacgagacc
ttccgagcattccttccaatgttggacaaggatcccctgccccaggacttttctgtgaag
atggctacactcttcaaggacttcatgactacctataaccggacttacgaatcaagggaa
gaagcccagtggcgcttgactgtctttgccagaaatatgatacgagcgcagaagattcag
gccctggaccgtggcacagctcagtatgggatcaccaagttcagtgacctcacagaggaa
gagttccacaccatctacctgaatcccctcttacaaaaggagtctggcgggaagatgagt
ctagccaagtccataaatgatctcgccccacctgaatgggactggaggaagaaaggggct
gtcactgaagtgaaggaccagggcatgtgtggctcctgctgggccttctctgtcacaggc
aacgtggagggccagtggttcctgaaccgggggactctgctctccctgtcagagcaggag
cttttggattgtgacaagatggacaaggcctgcatgggtggactgccctccaacgcctac
acagccataaagaatttgggagggctggagacagaggatgactatggctaccagggccac
gttcaagcctgtaacttctcaacacagatggcaaaagtctacatcaacgattcagtggag
ctgagccgggatgagaacaagatagcagcctggctggcccagaaaggaccgatctcagtt
gccattaatgccttcggcatgcagttctatcgccatgggattgctcacccattccggccc
ctctgcagcccttggttcatcgaccacgctgtgttgctggtgggctatggaaaccgctcc
aacattccttactgggccatcaagaacagctggggcagggactggggtgaggagggttac
tactacttatatcgtgggtccggggcctgtggtgtgaataccatggccagttcggcagtg
gtgaactga

KEGG   Rattus norvegicus (rat): 50654
Entry
50654             CDS       T01003                                 

Gene name
Ctss
Definition
(RefSeq) cathepsin S preproprotein
  KO
K01368  cathepsin S [EC:3.4.22.27]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
rno04145  Phagosome
rno04210  Apoptosis
rno04612  Antigen processing and presentation
rno05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    50654 (Ctss)
   04142 Lysosome
    50654 (Ctss)
  09143 Cell growth and death
   04210 Apoptosis
    50654 (Ctss)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    50654 (Ctss)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    50654 (Ctss)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    50654 (Ctss)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    50654 (Ctss)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.27  cathepsin S
     50654 (Ctss)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C1: papain family
   50654 (Ctss)
Chaperones and folding catalysts [BR:rno03110]
 Intramolecular chaperones
  Papain family
   50654 (Ctss)
SSDB
Motif
Pfam: Peptidase_C1 Inhibitor_I29 Peptidase_C1_2
Other DBs
NCBI-GeneID: 50654
NCBI-ProteinID: NP_059016
RGD: 621513
UniProt: Q02765
Position
2
AA seq 330 aa
MAVLGAPGVLCDNGATAERPTLDHHWDLWKKTRMRRNTDQNEEDVRRLIWEKNLKFIMLH
NLEHSMGMHSYSVGMNHMGDMTPEEVIGYMGSLRIPRPWNRSGTLKSSSNQTLPDSVDWR
EKGCVTNVKYQGSCGSCWAFSAEGALEGQLKLKTGKLVSLSAQNLVDCSTEEKYGNKGCG
GGFMTEAFQYIIDTSIDSEASYPYKAMDEKCLYDPKNRAATCSRYIELPFGDEEALKEAV
ATKGPVSVGIDDASHSSFFLYQSGVYDDPSCTENMNHGVLVVGYGTLDGKDYWLVKNSWG
LHFGDQGYIRMARNNKNHCGIASYCSYPEI
NT seq 993 nt   +upstreamnt  +downstreamnt
atggctgttttgggtgcccctggtgtgctctgtgacaatggagcaactgcagagagacct
accctggaccaccactgggatctctggaagaaaactcgcatgagaaggaatacagatcag
aatgaagaagacgtacgacgtctcatctgggaaaagaatctcaagtttataatgcttcac
aatctggaacattctatgggaatgcattcatacagtgtgggcatgaaccacatgggagac
atgacacctgaagaagtcataggttatatgggctctctgagaattcccaggccctggaat
agaagtggcactctcaagtcaagctctaatcagacattgcccgactctgtggactggcga
gaaaagggctgcgtcactaatgtgaaataccagggctcttgtggttcctgctgggctttc
agcgccgagggggcccttgaagggcagctgaagctgaaaacggggaagctggtgtctctc
agtgctcagaacctggtggattgctcaaccgaagaaaagtacgggaataaaggctgcggg
ggtggcttcatgaccgaagctttccagtacatcatcgatacgagcatcgactcagaagct
tcctatccctacaaagccatggatgaaaagtgtctctatgacccaaaaaatcgagctgcc
acgtgttcaaggtacattgagctccccttcggcgatgaagaagctctgaaagaagcagtg
gccactaaagggcctgtctctgtgggcatcgacgacgccagccattcctccttcttcctc
taccaaagtggtgtctatgatgacccctcctgtaccgagaatatgaatcatggtgttctc
gtggttggctatgggactcttgatgggaaagactactggcttgtgaaaaacagttggggc
cttcactttggtgatcaaggatatattcggatggcgagaaataacaaaaatcactgcggg
attgctagctattgctcttacccagaaatctaa

KEGG   Rattus norvegicus (rat): 64529
Entry
64529             CDS       T01003                                 

Gene name
Ctsb
Definition
(RefSeq) cathepsin B preproprotein
  KO
K01363  cathepsin B [EC:3.4.22.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04140  Autophagy - animal
rno04142  Lysosome
rno04210  Apoptosis
rno04612  Antigen processing and presentation
rno04621  NOD-like receptor signaling pathway
rno04924  Renin secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    64529 (Ctsb)
   04140 Autophagy - animal
    64529 (Ctsb)
  09143 Cell growth and death
   04210 Apoptosis
    64529 (Ctsb)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    64529 (Ctsb)
   04612 Antigen processing and presentation
    64529 (Ctsb)
  09152 Endocrine system
   04924 Renin secretion
    64529 (Ctsb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    64529 (Ctsb)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    64529 (Ctsb)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    64529 (Ctsb)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    64529 (Ctsb)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.1  cathepsin B
     64529 (Ctsb)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C1: papain family
   64529 (Ctsb)
Chaperones and folding catalysts [BR:rno03110]
 Intramolecular chaperones
  Papain family
   64529 (Ctsb)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   64529 (Ctsb)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Others
   64529 (Ctsb)
SSDB
Motif
Pfam: Peptidase_C1 Propeptide_C1
Other DBs
NCBI-GeneID: 64529
NCBI-ProteinID: NP_072119
RGD: 621509
Ensembl: ENSRNOG00000010331
UniProt: Q6IN22
Structure
PDB: 
1THE 1CTE 1CPJ 1MIR

Position
15
AA seq 339 aa
MWWSLIPLSCLLALTSAHDKPSFHPLSDDMINYINKQNTTWQAGRNFYNVDISYLKKLCG
TVLGGPKLPERVGFSEDINLPESFDAREQWSNCPTIAQIRDQGSCGSCWAFGAVEAMSDR
ICIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWNFWTRKGLVSGGVYNSHIGCL
PYTIPPCEHHVNGSRPPCTGEGDTPKCNKMCEAGYSTSYKEDKHYGYTSYSVSDSEKEIM
AEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDVMGGHAIRILGWGIENGVPYWLVANSW
NVDWGDNGFFKILRGENHCGIESEIVAGIPRTQQYWGRF
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgtggtggtccttgatccctctctcttgcctgctggcactgaccagtgcccatgacaag
ccttcctttcacccactgtcggacgacatgattaactatatcaacaaacagaatacaaca
tggcaggctggacgcaacttctacaatgttgacataagctatctgaagaagctgtgtgga
actgtcctgggtggacccaagctgccggaaagggttgggttcagcgaggacataaatcta
cctgaatcctttgatgcacgggaacagtggtccaattgcccgaccatcgcacagatcaga
gaccaggggtcctgtggctcttgttgggcatttggggcagtggaagccatgtctgaccga
atctgcattcacaccaatggccgagtcaatgtggaggtgtctgctgaggacctgcttacc
tgctgtggtatccagtgtggggatggctgtaatggtggctatccctctggagcatggaac
ttctggactagaaaaggcctggtttctggtggagtatacaattctcatataggctgctta
ccctacaccatccctccctgtgaacaccatgtcaatggctcccgtcccccatgcactgga
gaaggagatactcccaagtgcaacaagatgtgtgaggctggctactccacatcctacaag
gaagataagcactatgggtacacttcctacagtgtgtctgacagcgagaaggagatcatg
gcggaaatctacaaaaatggcccagtggagggtgcttttactgtgttttctgacttcttg
acttacaaatcaggcgtatacaagcatgaagccggtgatgtgatgggaggccatgccatc
cgcattctgggctggggaatagagaatggagtaccctactggctggtagcaaactcctgg
aacgttgactggggtgataatggtttctttaaaatcctcagaggagagaaccactgtgga
attgaatcagaaatcgtggctggaatcccacgcactcagcagtactggggaagattctaa

KEGG   Rattus norvegicus (rat): 684529
Entry
684529            CDS       T01003                                 

Gene name
Ctso
Definition
(RefSeq) cathepsin O
  KO
K01374  cathepsin O [EC:3.4.22.42]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
rno04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    684529 (Ctso)
  09143 Cell growth and death
   04210 Apoptosis
    684529 (Ctso)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    684529 (Ctso)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.42  cathepsin O
     684529 (Ctso)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C1: papain family
   684529 (Ctso)
SSDB
Motif
Pfam: Peptidase_C1 Peptidase_C1_2
Other DBs
NCBI-GeneID: 684529
NCBI-ProteinID: XP_038959660
RGD: 1589156
Position
2
AA seq 311 aa
MKPHAASLLLLCCCCLGRGVARTWPWSPQREAAALRESLNRHRYLNSFPHDNSTAFYGVN
QFSYLFPEEFKALYLGSKPAWAPRYPAKGQTPIPNVSLPLRFDWRDKHVVNHVRNQKTCG
GCWAFSVVSAVESAGAIQGKPLDYLSVQQVIDCSFNNYGCRGGSPLGALSWLNETQLKLV
ADSQYPFKAENGLCRYFPPSQSGVSVKGFSAYDFSNQEDEMARALLSFGPLVVIVDAVSW
QDYLGGIIQHHCSSGEANHAVLITGFDKTGNTPYWMVRNSWGNSWGVEGYAYVKMGGNVC
GIADSVAAVFV
NT seq 936 nt   +upstreamnt  +downstreamnt
atgaagcctcacgcggccagccttttgctgctgtgttgctgctgtctcggccgcggggtc
gcccggacctggccttggagcccccagcgggaggcggctgccttgcgggaaagccttaac
agacaccgatacttgaactctttccctcatgacaactccactgccttctatggagtaaat
cagttttcttacttgtttcctgaagagtttaaagctttgtatttgggaagcaaacctgcc
tgggctcccagatacccagcaaaaggacagacacctatccccaatgtgtctttgccattg
agatttgactggagggacaagcatgttgtaaatcacgtaagaaaccaaaagacgtgtgga
ggatgctgggccttcagcgtggtcagtgcagtagagtcagctggtgcgatccaagggaaa
cccctggattacctgagcgtgcagcaagtcattgactgctcctttaataattatggctgc
cgcggtggctctcctctcggtgccttgagctggctaaatgagacacagttgaagttggtg
gcggattcacagtacccattcaaggcagaaaatggcctgtgtcgctacttccctccatca
caatctggagtttcagtcaagggtttttctgcatatgacttcagtaaccaagaagatgaa
atggccagagccctactgtccttcggccctttggttgtgatagttgatgcagtgagctgg
caggattatctggggggcataatccagcatcactgctccagtggggaggcaaaccacgcg
gttctcatcacaggctttgataaaacaggaaatactccatattggatggtgcgaaactcc
tggggaaactcctggggagtagaaggctatgcctacgtgaaaatgggaggtaatgtttgt
ggcattgcagactctgttgctgctgtcttcgtgtga

DBGET integrated database retrieval system