KEGG   Rattus norvegicus (rat): 171299Help
Entry
171299            CDS       T01003                                 

Gene name
Foxd1, BF-2, Hfhbf2
Definition
(RefSeq) forkhead box D1
  KO
K09397  forkhead box protein D
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    171299 (Foxd1)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Helix-turn-helix
   Fork head/winged helix other regulators
    171299 (Foxd1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Forkhead
Motif
Other DBs
NCBI-GeneID: 171299
NCBI-ProteinID: NP_599164
RGD: 621712
Ensembl: ENSRNOG00000043332
UniProt: D3ZP43
Position
2q12
AA seq 455 aa AA seqDB search
MTLSTEMSDASGLAEETDIDVVGEGEDEEEEEDDDDEGGGGSQLPSSAQRRRRSYAGEDE
LEDLEEEDDDEDLLLASRPAASPAPPGPAPAPGAGSGGCSGAGAGGGAGGGVGAGAGTGG
GGSSKNPLVKPPYSYIALITMAILQSPKKRLTLSEICEFISGRFPYYREKFPAWQNSIRH
NLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGSFLRRRKRFKRQPLLAPHAAAEA
LLLRGAGPAASAGDPGAALFPPPPPPTACGYGAYGCAYGLQLPPCAPPSALFAAAAAAAA
AAFHPHSPPPPPPPPPPPGAAAELARTAFGYRPHALAAALPGPLQAAAVKAGGPGTAALA
RSPFSIESLIGRTRGPATAGAHASPGATSGTAPGPGGGGCAVQAAAGPAVALTRSLVVAA
AAAASSVSSSAALGTLHQGTALSSVENFTARISNC
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgagcacagagatgtccgatgcctccggcctcgccgaggagacagacatcgac
gtggtgggggagggagaggacgaagaggaggaagaggacgatgacgacgagggcggcggc
gggtcccagttgcccagctcggcccagcggcggcggcgctcctacgccggggaggacgag
ctcgaggacctggaggaagaggacgacgacgaagacctgctgctggcctcgcggcctgcc
gcgtcccccgcgcctccgggtcctgcgcccgccccaggggccggatcgggcggctgcagc
ggcgcgggagcgggaggcggcgcgggaggtggcgtgggcgcgggcgcgggcacgggtggg
ggcgggagctccaagaacccgctggtgaagcctccctactcgtacatcgcgctcatcacc
atggccatcctgcagagccccaagaagcgcctgacgctcagcgagatctgcgagttcatc
agcggtcgcttcccttactaccgggagaagttccccgcctggcagaacagcatccgtcac
aacctgtcgctcaacgactgcttcgtcaagatcccgcgcgagcccggcaacccgggcaag
ggcaactactggacgctcgacccggagtccgcagacatgttcgacaacggcagcttcctg
cggcgccgcaagcgcttcaagcgccagccgttgctcgccccccacgcggcggccgaggcg
ctgctgctgcgcggtgcggggcccgcggcgagcgcaggggacccgggcgccgcgctcttc
ccgccgccgcccccgccgaccgcctgcggctatggagcctacggctgcgcctacggcctg
cagctgccgccctgcgcgccgccctccgcgctcttcgctgccgccgccgccgcagccgct
gccgccttccacccgcactcacccccgccaccgccgccgccgccgcctcctcccggcgcg
gccgccgagctggcgcggaccgccttcggctaccggccgcatgcgctggccgccgccctg
cccggcccgttgcaggcggccgcagtcaaggcgggaggcccgggcaccgcagcgctcgca
cgctcgcccttctccattgagagcctcatcgggcgcactcggggtcccgcgaccgccggt
gcacacgcctcgcctggggccaccagcgggaccgcaccgggccccgggggcggaggctgc
gccgtgcaagcggctgcgggtcccgccgtcgcgctcacccgctcgctggtggtcgccgcc
gcggctgctgcctcctccgtgtcgtcgtccgccgcgctgggtactctgcaccaagggact
gcgctgtccagtgtggagaactttactgctaggatttccaattgttag

DBGET integrated database retrieval system