KEGG   Rattus norvegicus (rat): 171304Help
Entry
171304            CDS       T01003                                 

Gene name
Kif11, Knsl1
Definition
(RefSeq) kinesin family member 11
  KO
K10398  kinesin family member 11
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    171304 (Kif11)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    171304 (Kif11)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    171304 (Kif11)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     171304 (Kif11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kinesin Microtub_bind Microtub_bd SpoIIID
Motif
Other DBs
NCBI-GeneID: 171304
NCBI-ProteinID: NP_001162583
RGD: 621258
Ensembl: ENSRNOG00000056069
UniProt: F1MAB8
Position
1q53
AA seq 1056 aa AA seqDB search
MASQPSSSSKKKEEKGKNIQVVVRCRPFNLAERKANAHSVVECDHARKEVSVRTAGLTDK
TSRKTYTFDMVFGASTKQIDVYRSVVCPILDEVIMGYNCTIFAYGQTGTGKTFTMEGERS
PNEVYTWEEDPLAGIIPRTLHQIFEKLTDNGTEFSVKVSLLEIYNEELFDLLSPSSDVSE
RLQMFDDPRNKRGVIIKGLEEITVHNKDEVYQILEKGAAKRTTAATLMNAYSSRSHSVFS
VTIHMKETTIDGEELVKIGKLNLVDLAGSENIGRSGAVDKRAREAGNINQSLLTLGRVIT
ALVERTPHIPYRESKLTRILQDSLGGRTRTSIIATISPASLNLEETLSTLEYAHRAKNIM
NKPEVNQKLTKKALIKEYTEEIERLKRDLAAAREKNGVYISEESFRAMNGKVTVQEEQIA
ELAEKIGVLEEELSKAAELFTDSEKELNQCKSDLQTKTQELETTQKHLQETKLQLVKEEY
VSSALERTEKKLHETASKLLNTVKETTRDVSGLHSKLDRKRAIDAHNAEAQESFGRSLSS
LFNNMEELIRDGSEKQKAMLDVHKALFGNLMSSSVSALDTISTTALESLMSIPENVLARV
SQISDMILEEQSLAAQSKTVLQGSIDELVTNLFTSLKTIIAPGVVSILNINRQLQHIFRA
SVTMAEKVEDQKREIDSFLSILCNNLHELRENTVSSLVESQKLCGNLTEDLKTIKETHSQ
ELCQLSSSWAERFCALEKKYANIQKPLNSIQENTERKSTDIINKTTVHSKKILADSDGLL
QELRHFNEEGTQLVEDSVGHCGSLSSNLETVSQEITQRCGTLNTSTVHFSDQWASCLSKR
KEELQNLMEFVNGCCEASSSEITEKIRGHRAAIESQHSSFVVQITSDEEKFKAGSLELDK
TIKTGLTKLNCFLQQDLKLDIPTGMTPERKNYLYPSTLVRTEPREQLLDQLQKKQPKPLM
MLNCSESSKETSQDMEEDREVLEQSTEELVSQEPCVHTSADCSSSGGVPFFQHKKPHGKD
KENRGLNPVEKGKVEEASEHSISKSRLPLRASINLC
NT seq 3171 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcccagccgagttcttcttcgaagaagaaagaggaaaagggcaagaacattcag
gtggtggtgagatgcagaccatttaatttggcagagcggaaagctaacgcccactctgta
gtagaatgtgatcacgcacggaaggaagtcagtgtacgaactgcagggctgactgacaag
acctcaaggaaaacatacacgtttgacatggtgtttggagcatctacaaaacaaattgat
gtttaccgaagtgttgtttgtccaattctagatgaagttattatgggctataattgtacc
atcttcgcatatggccagactggcactggaaaaacttttacaatggaaggtgaaaggtca
cctaatgaagtatatacctgggaggaggatcctctggctggtataattccacgtactctt
catcagatttttgagaaacttactgataatggcactgagttttcagtgaaagtatcccta
ttggaaatctataatgaggagctttttgatcttctgagtccgtcttctgatgtttctgaa
aggctgcagatgtttgatgatccccggaacaagagaggagtgataatcaaaggcttagag
gaaatcacagtacacaacaaagatgaagtctaccaaatcttagagaagggggcagccaaa
aggacaactgcagcaaccttgatgaatgcttactccagtcgttcacactcagttttttct
gtcacgatacacatgaaagaaacgacaattgatggagaagagcttgttaaaattggcaag
ttgaatttggttgatcttgcaggaagtgaaaatattgggcgttctggagctgttgacaag
agggcccgggaagctggaaatatcaaccagtccctgctgactctggggagagttatcact
gctcttgtggaaagaacacctcatattccttatcgagaatctaaactaacaagaatcctg
caagattctcttggggggcgtacaaggacatctataattgcaaccatttcccctgcgtct
ctcaatcttgaggaaactctgagtacattggaatatgctcacagagcaaagaacataatg
aataagcctgaagttaatcagaaactcaccaaaaaggcacttattaaggagtatacagaa
gagatagagcgtttgaagcgagatcttgcagcagctcgtgagaaaaatggagtgtacatc
tctgaagaaagtttcagagccatgaatggaaaagtaactgttcaggaggaacaaattgct
gagttggctgaaaaaattggtgtccttgaggaggagctcagtaaggctgcagagttattt
acggatagtgaaaaggaacttaatcagtgtaaatctgacctgcaaaccaagacacaggaa
cttgaaaccactcagaaacatttgcaagaaacaaaattacaacttgttaaagaggagtat
gtctcttcagctttggaaagaactgagaagaagcttcatgaaacggccagcaagttgctt
aacacagttaaagaaaccaccagggacgtatctggtctgcattctaaactggaccggaag
agagcaatcgatgcgcacaacgctgaggctcaggagagctttggcaggagcctcagcagt
ctgtttaataatatggaagagttgatcagggacggcagtgagaaacagaaggccatgctg
gacgttcacaaagcactgttcggtaacctgatgtcttctagtgtctctgcattagacact
atttccacgacagcacttgaatctctcatgtctattccagaaaacgtgttagctcgtgtt
tctcagatttctgatatgatattggaagagcagtcgttagcagcccagagtaaaactgtg
ctgcaaggatcgattgatgaacttgtgaccaaccttttcacgtccctgaagaccatcata
gctcctggtgtggtgtccatcttaaacataaataggcaactacagcatattttcagggct
tcggtgacaatggctgaaaaggtagaagatcaaaaaagagaaatagacagttttctcagc
atattgtgtaacaatttacatgaactccgagaaaacactgtttcttccttggttgaatca
caaaagctttgtggaaacctaactgaagacctgaagacaataaaggaaacccattcacag
gaactttgccagttaagcagtagttgggcagagagattctgtgctttggagaagaagtat
gcaaacatccagaaaccactgaacagtattcaagaaaacacagagcggaagtctactgat
ataatcaataaaacaacagttcacagtaagaaaattcttgcagactctgatggattatta
caagaactcagacactttaacgaagaaggtacacagttggttgaagactctgtaggacac
tgtggttcactcagcagcaacctggagactgtatcccaagagatcacacagaggtgtggg
accctgaacacaagcacagttcatttttctgatcagtgggcatcctgcttaagcaagagg
aaggaagagcttcagaacttaatggagtttgtaaatggatgttgtgaagcttcaagttca
gagatcactgaaaaaataagaggacacagagcagctattgagagccagcacagctccttt
gttgttcagataacttctgatgaagaaaaatttaaagctggaagcctagagcttgataaa
actataaaaactggtttaacaaagcttaattgctttctgcaacaggatctgaaactagat
atcccaacaggtatgacaccagagaggaaaaattatttatatccatcaacacttgtgaga
actgaaccacgggagcaactccttgatcagctgcaaaagaaacagcccaagccactgatg
atgctaaattgctcagaaagcagcaaagagaccagtcaggacatggaggaggacagggag
gttctggagcagagtactgaagaactcgtaagtcaagagccgtgtgtacataccagtgcg
gattgctcttccagtggaggtgttccattttttcagcataaaaagccacatggaaaagac
aaagaaaacagaggccttaaccccgtggagaagggtaaagtggaggaggcctcggagcac
tccatctccaagagcagactgccgctgcgcgcctccatcaacctctgctga

DBGET integrated database retrieval system