KEGG   Rattus norvegicus (rat): 171305
Entry
171305            CDS       T01003                                 

Gene name
Clk3
Definition
(RefSeq) CDC-like kinase 3
  KO
K08823  dual specificity protein kinase CLK2/3 [EC:2.7.12.1]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    171305 (Clk3)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    171305 (Clk3)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     171305 (Clk3)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  CLK family
   171305 (Clk3)
Spliceosome [BR:rno03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    171305 (Clk3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr
Other DBs
NCBI-GeneID: 171305
NCBI-ProteinID: NP_599167
RGD: 621259
Ensembl: ENSRNOG00000030126
UniProt: Q63117
Position
8q24
AA seq 490 aa
MHHCKRYRSPEPDPYLSYRWKRRRSYSREHEGRLRYPSRREPPPRRSRSRSHDRIPYQRR
YREHRDSDTYRCEERSPSFGEDCYGSSRSRHRRRSRERGPYRTRKHAHHCHKRRTRSCSS
ASSRSQQSSKRSSRSVEDDKEGHLVCRIGDWLQERYEIVGNLGEGTFGKVVECLDHARGK
SQVALKIIRNVGKYREAARLEINVLKKIKEKDKENKFLCVLMSDWFNFHGHMCIAFELLG
KNTFEFLKENNFQPYPLPHVRHMAYQLCHALRFLHENQLTHTDLKPENILFVNSEFETLY
NEHKSCEEKSVKNTSIRVADFGSATFDHEHHTTIVATRHYRPPEVILELGWAQPCDVWSI
GCILFEYYRGFTLFQTHENREHLVMMEKILGPIPSHMIHRTRKQKYFYKGGLVWDENSSD
GRYVKENCKPLKSYMLQDSLEHVQLFDLMRRMLEFDPSQRITLAEALLHPFFAGLTPEER
SFHSSRNPSR
NT seq 1473 nt   +upstreamnt  +downstreamnt
atgcatcactgtaagcgataccgttccccagagccagacccatacctgagctaccgctgg
aagaggaggcggtcttacagtcgggagcatgaaggtcgactacgatacccatcccgaagg
gagcctcccccacggagatcaaggtccagaagccatgatcgtataccctaccagaggagg
taccgggaacaccgagacagcgatacatatcggtgtgaagagcggagcccatcctttgga
gaggactgctatgggtcttcacgttctcgacatcggagacggtcacgagagagggggccg
taccgtacacgcaagcatgcccaccactgtcacaaacgtcgtaccaggtcttgtagcagc
gcctcctcgagaagccaacagagcagtaagcgcagcagccggagtgtggaagatgacaag
gagggccacctggtgtgccggatcggcgattggctccaagagcgatatgagatcgtgggg
aacctgggtgaaggcacctttggcaaggtggtggagtgcttggaccatgccagagggaag
tcacaggttgccctgaagatcatccgtaatgtgggcaagtaccgggaagctgctcgtcta
gaaattaatgttctcaagaaaatcaaggagaaagacaaagaaaataagttcctttgtgtc
ctgatgtctgactggttcaacttccatggtcatatgtgtatcgcctttgagctcctgggc
aagaacacctttgagttcctgaaggagaacaacttccagccttatcccctaccacatgtc
cggcacatggcctaccagctctgtcatgcccttagatttctacatgagaaccagctgacc
cacacagacttgaagccagagaacatcttgtttgtgaattctgagtttgaaaccctctac
aatgagcacaagagctgcgaggagaagtcagtgaagaacaccagcatccgagtggcagac
tttggcagtgccacatttgaccatgaacatcacaccaccattgtcgccacccggcattac
cgcccacctgaggtgatccttgagctgggctgggcacagccctgtgatgtctggagtatc
ggctgcattctctttgagtactaccgtggctttacactcttccagacccatgaaaacaga
gaacacttggttatgatggagaagatcctaggacccatcccatcacacatgatccaccgt
accaggaagcagaagtatttctacaaagggggcctggtttgggatgagaacagctctgac
gggcggtatgtgaaggagaactgcaaacctctgaagagttacatgctccaggactccctg
gagcatgtgcagctgtttgacctgatgaggaggatgttagagttcgacccgtctcagcgc
atcacactggcagaagctttgctgcaccccttctttgctggcctgacccctgaggagcgg
tccttccacagcagccgtaaccccagcagatga

DBGET integrated database retrieval system