KEGG   Rattus norvegicus (rat): 171347
Entry
171347            CDS       T01003                                 

Gene name
Mat2a
Definition
(RefSeq) S-adenosylmethionine synthase isoform type-2
  KO
K00789  S-adenosylmethionine synthetase [EC:2.5.1.6]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00270  Cysteine and methionine metabolism
rno01100  Metabolic pathways
rno01230  Biosynthesis of amino acids
rno01240  Biosynthesis of cofactors
Module
rno_M00034  Methionine salvage pathway
rno_M00035  Methionine degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    171347 (Mat2a)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.6  methionine adenosyltransferase
     171347 (Mat2a)
SSDB
Motif
Pfam: S-AdoMet_synt_C S-AdoMet_synt_M S-AdoMet_synt_N AdoMet_Synthase DUF520
Other DBs
NCBI-GeneID: 171347
NCBI-ProteinID: NP_599178
RGD: 619985
Ensembl: ENSRNOG00000013520
UniProt: P18298
Position
4
AA seq 395 aa
MNGQLNGFHEAFIEEGTFLFTSESVGEGHPDKICDQINDAVLDAHLQQDPDAKVACETVA
KTGMILLAGEITSRAAIDYQKVVREAIKHIGYDDSSKGFDYKTCNVLVALEQQSPDIAQG
VHLDRNEEDIGAGDQGLMFGYATDETEECMPLTIVLAHKLNAKLAELRRNGTLPWLRPDS
KTQVTVQYMQDRGAVIPIRVHTIVISVQHDEEVCLDEMRDALKEKLIKAVVPAKYLDEDT
IYHLQPSGRFVIGGPQGDAGLTGRKIIVDTYGGWGAHGGGAFSGKDYTKVDRSAAYAARW
VAKSLVKGGLCRRVLVQVSYAIGVSHPLSISIFHYGTSQKSERELLEIVKNNFDLRPGVI
VRDLDLKKPIYQRTAAYGHFGRDSFPWEVPKKLKY
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgaacgggcagctcaacggcttccatgaggcgttcatcgaggaggggacattccttttc
acttcagagtctgtaggggaaggtcatccagataagatttgtgaccaaatcaatgatgct
gtccttgatgcacaccttcagcaggaccctgatgctaaagtggcttgtgaaactgttgct
aaaactggaatgatccttcttgctggggaaattacatctagagctgccattgattaccag
aaagtggttcgtgaagccataaagcacattggctatgatgattcttccaaagggtttgac
tacaagacttgtaatgtgttggttgccttggaacaacagtcaccagatatcgcccaaggt
gttcatcttgaccggaatgaggaagacattggtgcaggagatcagggtttgatgtttggt
tatgccactgatgaaactgaagagtgtatgcctttaactattgtcttagcacacaagcta
aatgctaaactggctgagctacgccgcaatggcacattgccttggttacgcccagattct
aaaactcaagtgactgtgcagtatatgcaagatcgaggtgctgtgattcccatcagagtc
catacaattgttatatctgttcagcatgatgaagaagtttgtcttgatgaaatgagggat
gctctgaaggagaaattgatcaaagctgttgtacctgcaaagtaccttgatgaggataca
atttaccacctacagccaagtggcagattcgttattggtgggcctcagggtgatgctggt
ttgactggccgaaaaatcattgtggatacttatggcggttggggagctcatggaggaggg
gccttttcaggaaaggattataccaaagtggaccgttcagctgcttatgctgctcgttgg
gtggcaaaatcccttgttaaaggaggtctgtgcaggagggttcttgttcaggtctcttat
gctattggagtttctcatccattgtcgatctccattttccattatggtacttctcagaag
agtgagagagagctattagaaattgtgaagaataattttgatcttcgccctggggtcatt
gtcagggatctggatctgaagaagccaatttatcagaggactgcagcctatggccacttt
ggtagggacagcttcccctgggaagtgcccaaaaagcttaaatattga

KEGG   Rattus norvegicus (rat): 25331
Entry
25331             CDS       T01003                                 

Gene name
Mat1a
Definition
(RefSeq) S-adenosylmethionine synthase isoform type-1
  KO
K00789  S-adenosylmethionine synthetase [EC:2.5.1.6]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00270  Cysteine and methionine metabolism
rno01100  Metabolic pathways
rno01230  Biosynthesis of amino acids
rno01240  Biosynthesis of cofactors
Module
rno_M00034  Methionine salvage pathway
rno_M00035  Methionine degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    25331 (Mat1a)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.6  methionine adenosyltransferase
     25331 (Mat1a)
SSDB
Motif
Pfam: S-AdoMet_synt_C S-AdoMet_synt_M S-AdoMet_synt_N AdoMet_Synthase
Other DBs
NCBI-GeneID: 25331
NCBI-ProteinID: NP_036992
RGD: 3050
Ensembl: ENSRNOG00000011351
UniProt: P13444
Structure
PDB: 
1QM4 1O90 1O92 1O93 1O9T

Position
16
AA seq 396 aa
MNGPVDGLCDHSLSEEGAFMFTSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETV
CKTGMVLLCGEITSMAMIDYQRVVRDTIKHIGYDDSAKGFDFKTCNVLVALEQQSPDIAQ
CVHLDRNEEDVGAGDQGLMFGYATDETEECMPLTIVLAHKLNTRMADLRRSGVLPWLRPD
SKTQVTVQYVQDNGAVIPVRVHTIVISVQHNEDITLEAMREALKEQVIKAVVPAKYLDED
TIYHLQPSGRFVIGGPQGDAGVTGRKIIVDTYGGWGAHGGGAFSGKDYTKVDRSAAYAAR
WVAKSLVKAGLCRRVLVQVSYAIGVAEPLSISIFTYGTSKKTERELLEVVNKNFDLRPGV
IVRDLDLKKPIYQKTACYGHFGRSEFPWEVPKKLVF
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgaatggacctgtggatggcttgtgtgaccattctctaagtgaagagggagccttcatg
ttcacatctgaatcggtaggagaagggcatccagataagatctgtgaccagattagtgat
gcagtgctggatgcccatctcaagcaagaccccaatgccaaggtggcctgtgagacagtg
tgcaagacagggatggtgctcctgtgtggagagatcacctcaatggccatgattgactac
cagcgggtggtgagagacaccattaagcacattggctacgatgactctgccaagggcttc
gacttcaagacctgcaatgtgctcgtggctctggagcaacagtccccagacattgcccaa
tgtgtccatctagacagaaatgaggaggacgttggtgcaggagatcagggtctgatgttc
ggctatgccactgacgagacagaggagtgcatgccgctcaccattgttcttgctcacaaa
ctcaacacccggatggcagatctgaggcgctctggtgtccttccctggctgagacctgat
tctaagactcaggtaacagttcagtacgtgcaggataatggtgctgtcatccctgttcgc
gtccacaccatcgtcatctctgtgcaacacaacgaagacataacactggaggccatgcga
gaggccctgaaggagcaggtgatcaaagctgtggtgccagccaagtacctggatgaagac
accatctaccacctgcagccaagtgggcggtttgtcatcggaggtccccagggggatgca
ggtgtcacaggccgcaagattattgtggacacatacggaggctggggtgcccatggtggt
ggtgccttctctggaaaggactacaccaaggtggaccgctcagcagcttatgccgcccgc
tgggtggccaagtctctggtgaaggctgggctctgccggagagtccttgttcaggtgtcc
tatgccattggtgtggcagaacctctgtccatttccattttcacctacggaacttccaag
aagaccgagcgagagctactagaggttgtgaacaagaactttgatctccggccgggtgtt
attgtcagggacttggatctgaagaagcccatctaccagaagactgcatgctatggtcat
ttcggaagaagcgagtttccctgggaggtccccaagaagcttgtgttttag

KEGG   Rattus norvegicus (rat): 683630
Entry
683630            CDS       T01003                                 

Gene name
Mat2b
Definition
(RefSeq) methionine adenosyltransferase 2 subunit beta
  KO
K00789  S-adenosylmethionine synthetase [EC:2.5.1.6]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00270  Cysteine and methionine metabolism
rno01100  Metabolic pathways
rno01230  Biosynthesis of amino acids
rno01240  Biosynthesis of cofactors
Module
rno_M00034  Methionine salvage pathway
rno_M00035  Methionine degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    683630 (Mat2b)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.6  methionine adenosyltransferase
     683630 (Mat2b)
SSDB
Motif
Pfam: RmlD_sub_bind Epimerase GDP_Man_Dehyd Polysacc_synt_2 NAD_binding_4 DapB_N
Other DBs
NCBI-GeneID: 683630
NCBI-ProteinID: NP_001037747
RGD: 1593534
Ensembl: ENSRNOG00000003177
UniProt: Q5U2R0
Position
10
AA seq 334 aa
MVGREKELSIHFVPGCCQLVEEEVNIPSRRVLITGATGLLGRAVYKEFQQSNWHAVGCGF
RRARPKFEQVNLLDSEAVHHLIHDFQPHVIVHCAAERRPDVVESQPDAASQLNVGASGNL
AKEAAAIGAFLIYISSDYVFDGTNPPYTEEDIPSPLNLYGKTKLDGEKAVLENNLGAAVL
RIPVLYGEVEKLEESAVTVMFDKVQFSNKSANMDHWQQRFPTHVKDVASVCRQLAEKRML
DPSIKGTFHWSGNEQMTKYEMACAIADAFNLPSSHLRPITDSPVIGAQRPKNAQLDCSKL
ETLGIGQRTPFRIGIKESLWPFLIDKRWRQTVFH
NT seq 1005 nt   +upstreamnt  +downstreamnt
atggtgggccgtgagaaggagctctccatccatttcgtccccggctgctgccagctggtg
gaggaggaagtgaacatccctagccggcgggttctcattaccggtgccactgggcttctt
ggcagagcggtttacaaagagtttcagcagagcaactggcacgccgttggctgtggcttt
cgcagagcaagaccaaaattcgaacaggtgaacctgctggattctgaggcagttcatcac
ctcattcatgattttcagcctcacgtcatagtgcactgtgctgcagagagaagaccagat
gttgttgagagtcagccagatgctgcttcccagctgaatgtgggtgcctctgggaactta
gcaaaggaggcagctgcaattggagcatttctcatctacattagctcagattatgtgttt
gatggcacaaatcccccttacacagaagaagatataccaagtcccctgaatctgtacgga
aaaacaaagttagatggagaaaaggcggtcctggagaataatttaggggctgctgtgttg
agaattcctgttctgtatggggaggttgaaaagcttgaagaaagtgccgtgactgttatg
ttcgacaaggtgcagttcagcaataagtcagcgaacatggaccattggcagcagagattc
cccacacatgtgaaagacgtagccagtgtgtgccggcagctggcagagaagaggatgctg
gatccatccattaagggaacctttcactggtctggcaatgagcagatgaccaagtatgaa
atggcgtgtgcaattgcagacgccttcaacctccccagcagccacttacgacctattact
gacagccctgtcataggagcacaacgccccaaaaatgctcagcttgattgctccaaattg
gagaccttgggcattggccagcggacaccatttcgaattggaatcaaagaatcactctgg
cctttcctcatcgacaagagatggagacagactgtctttcattag

DBGET integrated database retrieval system