KEGG   Rattus norvegicus (rat): 171350Help
Entry
171350            CDS       T01003                                 

Gene name
Pabpc1, PABP_1, Pabp, Pabp1
Definition
(RefSeq) poly(A) binding protein, cytoplasmic 1
  KO
K13126  polyadenylate-binding protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno03015  mRNA surveillance pathway
rno03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    171350 (Pabpc1)
   03015 mRNA surveillance pathway
    171350 (Pabpc1)
  09123 Folding, sorting and degradation
   03018 RNA degradation
    171350 (Pabpc1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    171350 (Pabpc1)
   03041 Spliceosome [BR:rno03041]
    171350 (Pabpc1)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     171350 (Pabpc1)
   mRNA cycle factors
    Stress granule specific factors
     171350 (Pabpc1)
Spliceosome [BR:rno03041]
 Complex C
  Other components
   Complex C specific factors
    171350 (Pabpc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 PABP RRM_5 RRM_occluded RRM_3
Motif
Other DBs
NCBI-GeneID: 171350
NCBI-ProteinID: NP_599180
RGD: 619838
Ensembl: ENSRNOG00000008639
UniProt: Q9EPH8
Position
7q22
AA seq 636 aa AA seqDB search
MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQ
QPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFS
AFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKERE
AELGARAKEFTNVYIKNFGEDMDDERLKELFGKFGPALSVKVMTDESGKSKGFGFVSFER
HEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQMKQDRITRYQGVNLYVKN
LDDGIDDERLRKEFSPFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAVTEMNGRIVAT
KPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRA
AYYPPSQIAQLRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQ
RVANTSTQTMGPRPAAAATAATPAVRTVPQYKYAAGVRNPQQHLNAQPQVTMQQPAVHVQ
GQEPLTASMLASAPPQEQKQMLGERLFPLIQAMHPSLAGKITGMLLEIDNSELLHMLESP
ESLRSKVDEAVAVLQAHQAKEAAQKAVNSATGVPTV
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgaaccccagcgcccccagctaccccatggcctctctgtacgtgggggacctgcacccc
gacgtgaccgaggcgatgctctacgagaagttcagcccggccgggcccatcctctccatc
cgggtctgcagggacatgatcacccgccgctccttgggctacgcgtacgtgaacttccag
cagccggcggacgcggaacgtgctttggacaccatgaattttgatgttataaagggcaag
ccagtacgcatcatgtggtctcagcgtgatccatcacttcgtaaaagtggagtaggcaac
atattcattaaaaatttggacaaatccattgacaataaagcactgtatgatacgttttct
gcgtttggtaacatcctttcatgtaaggtggtttgtgatgaaaatggctccaagggctat
ggatttgtacattttgaaacacaggaagcagctgaaagagctattgaaaaaatgaatgga
atgcttctaaatgatcgtaaagtgtttgttggtcgatttaaatctcggaaggaacgagaa
gcagaacttggagcaagggcaaaggagttcaccaatgtttacatcaagaactttggagaa
gacatggatgatgagcgtcttaaggaactctttggcaagtttgggcctgccttaagtgtg
aaagtaatgacagatgaaagtggaaaatccaaaggatttggatttgtaagctttgaaagg
catgaagatgcgcagaaagctgtggatgagatgaatgggaaggagctcaatggaaaacag
atttatgttggtcgagctcagaaaaaagtggaacggcagacggaacttaagcgcaaattt
gagcagatgaagcaagacaggatcaccagatatcagggtgttaacctttatgtgaaaaat
cttgatgacggaattgatgatgagcgtctccggaaagagttttctccatttggtacaatc
actagtgcaaaagtaatgatggagggtgggcgcagcaaaggatttggttttgtatgtttc
tcctcccctgaagaagccactaaagcagttacggagatgaatggtagaattgtggccacc
aagccactctatgtagctttagctcagcgcaaagaagagcgccaggctcacctcactaac
cagtatatgcagaggatggcaagtgtacgagctgtgcccaatcctgtgatcaacccctac
cagccagcacctccttcaggttacttcatggcagctatcccacagactcagaaccgtgct
gcatactatcctcctagccaaattgctcaactaagaccaagtcctcgctggactgctcag
ggtgccagacctcatccattccagaatatgcccggtgctatccgcccagctgctcctaga
ccaccatttagtacgatgagaccagcttcctcacaggttccacgagtcatgtcaacacag
cgtgttgctaacacatcaacacagacaatgggtccacgtcctgcagctgctgctactgca
gccactcctgctgtccgcactgttccccagtataaatacgctgcgggagtccgcaatccc
cagcaacatcttaatgcacagccacaagttaccatgcaacagcctgcggttcatgtgcaa
ggtcaagaacctttaactgcttccatgttggcatctgcacccccgcaagagcaaaagcaa
atgttgggtgaacggctgtttcctcttattcaagccatgcacccttctcttgctggcaaa
attactggcatgctgttggagattgataactcagaattgcttcacatgcttgagtctcca
gagtctctccgctcaaaggtcgatgaagctgtagctgtactacaagcccaccaagcgaaa
gaggctgcccagaaagcagtgaacagtgccactggtgttccaactgtctaa

DBGET integrated database retrieval system