KEGG   Rattus norvegicus (rat): 171350
Entry
171350            CDS       T01003                                 

Gene name
Pabpc1
Definition
(RefSeq) polyadenylate-binding protein 1
  KO
K13126  polyadenylate-binding protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno03015  mRNA surveillance pathway
rno03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    171350 (Pabpc1)
   03015 mRNA surveillance pathway
    171350 (Pabpc1)
  09123 Folding, sorting and degradation
   03018 RNA degradation
    171350 (Pabpc1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    171350 (Pabpc1)
   03041 Spliceosome [BR:rno03041]
    171350 (Pabpc1)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     171350 (Pabpc1)
   mRNA cycle factors
    Stress granule specific factors
     171350 (Pabpc1)
Spliceosome [BR:rno03041]
 Complex C
  Other components
   Complex C specific factors
    171350 (Pabpc1)
SSDB
Motif
Pfam: RRM_1 PABP RRM_7 RRM_5 RRM_occluded RRM_3 ATP-grasp_2 YflT
Other DBs
NCBI-GeneID: 171350
NCBI-ProteinID: NP_599180
RGD: 619838
Ensembl: ENSRNOG00000008639
UniProt: Q9EPH8
Position
7
AA seq 636 aa
MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQ
QPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFS
AFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKERE
AELGARAKEFTNVYIKNFGEDMDDERLKELFGKFGPALSVKVMTDESGKSKGFGFVSFER
HEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQMKQDRITRYQGVNLYVKN
LDDGIDDERLRKEFSPFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAVTEMNGRIVAT
KPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRA
AYYPPSQIAQLRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQ
RVANTSTQTMGPRPAAAATAATPAVRTVPQYKYAAGVRNPQQHLNAQPQVTMQQPAVHVQ
GQEPLTASMLASAPPQEQKQMLGERLFPLIQAMHPSLAGKITGMLLEIDNSELLHMLESP
ESLRSKVDEAVAVLQAHQAKEAAQKAVNSATGVPTV
NT seq 1911 nt   +upstreamnt  +downstreamnt
atgaaccccagcgcccccagctaccccatggcctctctgtacgtgggggacctgcacccc
gacgtgaccgaggcgatgctctacgagaagttcagcccggccgggcccatcctctccatc
cgggtctgcagggacatgatcacccgccgctccttgggctacgcgtacgtgaacttccag
cagccggcggacgcggaacgtgctttggacaccatgaattttgatgttataaagggcaag
ccagtacgcatcatgtggtctcagcgtgatccatcacttcgtaaaagtggagtaggcaac
atattcattaaaaatttggacaaatccattgacaataaagcactgtatgatacgttttct
gcgtttggtaacatcctttcatgtaaggtggtttgtgatgaaaatggctccaagggctat
ggatttgtacattttgaaacacaggaagcagctgaaagagctattgaaaaaatgaatgga
atgcttctaaatgatcgtaaagtgtttgttggtcgatttaaatctcggaaggaacgagaa
gcagaacttggagcaagggcaaaggagttcaccaatgtttacatcaagaactttggagaa
gacatggatgatgagcgtcttaaggaactctttggcaagtttgggcctgccttaagtgtg
aaagtaatgacagatgaaagtggaaaatccaaaggatttggatttgtaagctttgaaagg
catgaagatgcgcagaaagctgtggatgagatgaatgggaaggagctcaatggaaaacag
atttatgttggtcgagctcagaaaaaagtggaacggcagacggaacttaagcgcaaattt
gagcagatgaagcaagacaggatcaccagatatcagggtgttaacctttatgtgaaaaat
cttgatgacggaattgatgatgagcgtctccggaaagagttttctccatttggtacaatc
actagtgcaaaagtaatgatggagggtgggcgcagcaaaggatttggttttgtatgtttc
tcctcccctgaagaagccactaaagcagttacggagatgaatggtagaattgtggccacc
aagccactctatgtagctttagctcagcgcaaagaagagcgccaggctcacctcactaac
cagtatatgcagaggatggcaagtgtacgagctgtgcccaatcctgtgatcaacccctac
cagccagcacctccttcaggttacttcatggcagctatcccacagactcagaaccgtgct
gcatactatcctcctagccaaattgctcaactaagaccaagtcctcgctggactgctcag
ggtgccagacctcatccattccagaatatgcccggtgctatccgcccagctgctcctaga
ccaccatttagtacgatgagaccagcttcctcacaggttccacgagtcatgtcaacacag
cgtgttgctaacacatcaacacagacaatgggtccacgtcctgcagctgctgctactgca
gccactcctgctgtccgcactgttccccagtataaatacgctgcgggagtccgcaatccc
cagcaacatcttaatgcacagccacaagttaccatgcaacagcctgcggttcatgtgcaa
ggtcaagaacctttaactgcttccatgttggcatctgcacccccgcaagagcaaaagcaa
atgttgggtgaacggctgtttcctcttattcaagccatgcacccttctcttgctggcaaa
attactggcatgctgttggagattgataactcagaattgcttcacatgcttgagtctcca
gagtctctccgctcaaaggtcgatgaagctgtagctgtactacaagcccaccaagcgaaa
gaggctgcccagaaagcagtgaacagtgccactggtgttccaactgtctaa

KEGG   Rattus norvegicus (rat): 291615
Entry
291615            CDS       T01003                                 

Gene name
Pabpc2
Definition
(RefSeq) poly(A) binding protein, cytoplasmic 2
  KO
K13126  polyadenylate-binding protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno03015  mRNA surveillance pathway
rno03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    291615 (Pabpc2)
   03015 mRNA surveillance pathway
    291615 (Pabpc2)
  09123 Folding, sorting and degradation
   03018 RNA degradation
    291615 (Pabpc2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    291615 (Pabpc2)
   03041 Spliceosome [BR:rno03041]
    291615 (Pabpc2)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     291615 (Pabpc2)
   mRNA cycle factors
    Stress granule specific factors
     291615 (Pabpc2)
Spliceosome [BR:rno03041]
 Complex C
  Other components
   Complex C specific factors
    291615 (Pabpc2)
SSDB
Motif
Pfam: RRM_1 PABP RRM_5 RRM_occluded RRM_3 HATPase_c
Other DBs
NCBI-GeneID: 291615
NCBI-ProteinID: NP_001099621
RGD: 1310759
Ensembl: ENSRNOG00000014527
UniProt: D4A233
Position
18
AA seq 630 aa
MNSSDPGCPMASLYVGDLHPDVTEAMLYEKFSSAGPILSIRVYRDVITRRSLGYASVNFE
QPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRRSGVGNVFIKNLNKTIDNKALYDTFS
AFGNILSCKVVCDENGSKGHGFVHFETEEAAERAIEKMNGMLLNDRKVFVGQFKSRKERE
AELGTRTKEFTNVYIKNFGDRMDDKTLNGLFGRFGQVLSVKVMTDEGGKSKGFGFVSFER
HEDAQKAVDEMNGKELNGKHIYVGPAQKKVDRHIELKRKFEQVTQDRGIRYQGINLYVKN
LDDGIDDERLQKEFSPFGTITSTKVMTEGGRSKGFGFVCFSSPEEATKAVSEMNGRIVAT
KPLYVALAQRKEERQAHLTNQYIQRMASVRSGPNSLINAYQPAPSGYSVAAVPQTQNCAP
CCPSQIVQPSPSTRWTAQGARPHPFPNVSGASHPAAPKSSFTTVRPSSSHVPQVMAAQRI
TNTSAQTTGQRPALASSPATTPVRSIPQYKYATGVRNSQQHLNAQLVQQPSVCIQGQEPW
TASTLGTAPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSEPLHMLDSPESLCSR
AQEAVSALQAHQANEAAQKAAGSTSGVPTV
NT seq 1893 nt   +upstreamnt  +downstreamnt
atgaactccagcgacccaggctgccccatggcctcgctctatgtgggggacctgcaccct
gatgtgacagaggcgatgctctatgagaagttcagctccgccgggcccatactttccatc
cgggtatacagggatgtgatcacacgtcgctccctgggctatgcttccgtgaactttgag
cagcctgctgatgcagagcgtgctttggacaccatgaattttgatgtcatcaagggcaag
ccagtccgcatcatgtggtctcagcgtgatccatcacttcgcaggagtggagtaggcaac
gtgttcattaaaaatttaaacaagaccattgacaataaagcgctatatgatacattctct
gcttttggcaatatcctttcctgcaaggtggtctgcgatgagaatggctcgaagggccat
ggatttgtacattttgagacagaggaggcagcggaaagagccatcgagaaaatgaacggg
atgcttctgaatgaccgcaaagtgtttgttggacagtttaagtctcggaaagaacgagaa
gcagagcttggaacgaggaccaaggagtttaccaacgtttacatcaagaactttggggac
cgcatggatgataagaccctgaatggcctcttcggcaggtttggacaggtcctaagtgtg
aaagtcatgaccgacgaaggtggaaaatcaaaaggattcgggttcgtcagctttgaaagg
cacgaagatgcgcagaaagcggtggatgagatgaatgggaaggaactcaatggaaaacac
atttatgtgggcccagctcagaaaaaggtggaccgtcacatagaacttaagcgcaaattt
gagcaggtgacccaagacaggggcatcagataccagggcattaacctttatgtgaaaaat
ctcgatgatggtattgatgatgaacgtcttcagaaagaattttctccgtttggaacaatc
accagtacaaaggttatgacagagggtggtcgcagtaaaggattcggttttgtgtgtttc
tcctccccagaagaagccacaaaagctgtttcagaaatgaatggtagaattgtggccacg
aaaccactttatgtagctttagcccagcgcaaagaagaacgtcaggctcatctcactaac
caatatattcaaagaatggcaagtgtccgatctgggccgaactctcttatcaacgcttac
caaccagcaccttctggctactccgtggctgctgtcccacaaactcagaactgtgcccca
tgctgccctagccaaattgttcaaccaagtccaagtactcgctggactgctcagggggcc
cggcctcatccattccccaacgtgtctggtgctagccaccctgctgctcctaaatcgtcg
tttactacggtaagaccaagttcttcacatgttcctcaagtcatggcagcacagcgcatc
actaacacatcagcacagacaacgggtcaacgtcctgccctagcctcttcacctgcaact
actcctgttcgctcgattccacagtataagtatgccacaggagtccggaactcccagcaa
catcttaatgcccagctggtgcaacagccttctgtttgcatacagggccaggaaccttgg
actgcttccacattaggaactgctcctcaagagcaaaagcaaatgttgggtgaaaggtta
tttcctctcattcaagccatgcacccgaccctggctggtaagatcacgggcatgttgctg
gagattgataactcggaaccacttcatatgctcgactctccagagtctctgtgttctaga
gctcaggaagccgtgtcggcactccaggcccaccaagctaacgaggctgcccagaaagct
gctggcagtacctctggtgtcccaactgtttaa

KEGG   Rattus norvegicus (rat): 292295
Entry
292295            CDS       T01003                                 

Gene name
Pabpc6
Definition
(RefSeq) poly(A) binding protein, cytoplasmic 6
  KO
K13126  polyadenylate-binding protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno03015  mRNA surveillance pathway
rno03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    292295 (Pabpc6)
   03015 mRNA surveillance pathway
    292295 (Pabpc6)
  09123 Folding, sorting and degradation
   03018 RNA degradation
    292295 (Pabpc6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    292295 (Pabpc6)
   03041 Spliceosome [BR:rno03041]
    292295 (Pabpc6)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     292295 (Pabpc6)
   mRNA cycle factors
    Stress granule specific factors
     292295 (Pabpc6)
Spliceosome [BR:rno03041]
 Complex C
  Other components
   Complex C specific factors
    292295 (Pabpc6)
SSDB
Motif
Pfam: RRM_1 PABP RRM_7 RRM_5 RRM_3 RRM_occluded HATPase_c
Other DBs
NCBI-GeneID: 292295
NCBI-ProteinID: NP_001099678
RGD: 1311201
Ensembl: ENSRNOG00000017367
UniProt: B5DF80
Position
1
AA seq 643 aa
MNPSDPSYSLASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVYRDRTTRRSLGYASVNFQ
QLEDAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFVKNLDRSIDSKTLYDTFS
AFGNILSCKVVCDENGSKGYGFVHFETQEEAERAIEKMNGMFLNDRKVFVGRFKSRRDRQ
AELGARAKEFTNVYIKNLGEDMDDERLQDLFSRFGPALSVKVMTDESGKSKGFGFVSFER
HEDARKAVDEMNGKDLNGKQIYVGRAQKKVERQTELKHKFGQMKQDKPKIEQVPQDRSVR
CQGVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVTMEGGRSKGFGFVCFSSPEEATKAV
TEMNGRIVATKPLYVALAQRKEERQAHLSNQYMQRMASTSAVPNPGINPFQPAQGLSGYF
MTATAPTQNRGTYYAPNQTTQQGPSARGSAQGTRAHPFQNMSSAIHPSNTMPSFSTSGPT
SSQAVRHRTASTSTQMMGPHPAAASTAAAPAARTVTQYKYTAGVRNPPQHLNTQPQVTTQ
RSAVSAQGKESLTVSMLASAPPQAQKQMLGEWLFSLIQAMHPALAGKITGMLLEIDNLEL
RHMLESPECLHTKVDEAIAVLQAHQAKETSQKAVSSVAGVPTS
NT seq 1932 nt   +upstreamnt  +downstreamnt
atgaaccccagcgaccccagctactccttggcttcactctatgtgggggacctgcacccc
gacgtgaccgaggcgatgctctacgagaaattcagcccggcagggcccatcctctccatc
cgggtgtacagggacagaaccacccgccgctcgctgggctacgcgtctgtaaacttccag
cagctggaggatgccgagcgggccttggacaccatgaatttcgatgtgataaagggcaag
ccggttcgcatcatgtggtctcagcgggacccatcgctgcgcaagagtggggtaggcaac
atattcgtcaaaaatctggacagatccattgacagtaaaacgctgtatgatacgttttct
gccttcggtaacatcctttcctgtaaggtggtgtgtgatgagaatggttccaagggttat
ggattcgtacacttcgagacacaggaagaagccgaacgagcaattgagaaaatgaacggg
atgttcctaaatgaccgcaaagtgttcgttgggcgctttaagtctcgtagagaccggcag
gctgaacttggagccagggccaaggagttcaccaacgtttacatcaagaatttgggagaa
gacatggatgatgaaagactccaggatctcttcagcagatttgggcctgccttaagtgtt
aaagtcatgactgatgaaagtggaaagtccaaaggattcggatttgtaagctttgaaagg
catgaagatgcacgaaaggcagtggatgaaatgaacggaaaagacctcaatggaaaacaa
atttatgtaggtcgagctcagaaaaaggtggaacgacagactgaactgaagcacaaattc
gggcagatgaagcaagataagcccaaaattgaacaggtaccacaagatagaagcgtcaga
tgccaaggtgttaacctttacgtgaaaaacctcgatgatggtattgatgacgagcgtctc
cggaaggagttttctccgtttgggactatcactagtgcaaaggtaacgatggagggtggg
cgcagcaaaggatttggttttgtatgtttctcctctccagaagaagccaccaaagccgtt
acagaaatgaatggcagaatagtggcaaccaaaccactgtacgtagctttagctcaacgc
aaagaggagcgccaggctcacctcagtaaccagtacatgcagagaatggcaagcaccagt
gccgtgcccaacccaggcatcaaccctttccagccagcacagggtctttcaggatacttc
atgacagctacagcaccgactcagaaccgtgggacatactatgctcctaaccaaactact
cagcaaggaccaagtgcccgtgggagtgctcagggtaccagagcgcatccattccaaaac
atgtctagtgccatccacccatctaatactatgccatcatttagtacttcaggacccact
tcctcacaggctgtacgacaccgtactgccagcacatccacacagatgatgggtccacat
cctgcagctgcttctactgcagctgctcctgccgcccgcacagttactcagtataaatat
actgctggagtccgaaatccccctcagcatcttaatacacagccacaggtcaccacgcag
cggtctgctgtttctgcccaaggtaaagaatctttgactgtctccatgttggcatctgct
cctcctcaagctcaaaagcaaatgttaggggaatggctattttctcttattcaggccatg
caccctgcccttgccggtaaaatcaccggtatgctgttggaaattgataatttagagcta
cgccacatgcttgagtctccagagtgtctccacaccaaagtcgatgaagccatagctgta
ctgcaagcccaccaagctaaagagacttcccagaaagcagtcagcagtgttgctggtgtc
ccaacttcttaa

KEGG   Rattus norvegicus (rat): 295010
Entry
295010            CDS       T01003                                 

Gene name
Pabpc4l
Definition
(RefSeq) polyadenylate-binding protein 4-like
  KO
K13126  polyadenylate-binding protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno03015  mRNA surveillance pathway
rno03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    295010 (Pabpc4l)
   03015 mRNA surveillance pathway
    295010 (Pabpc4l)
  09123 Folding, sorting and degradation
   03018 RNA degradation
    295010 (Pabpc4l)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    295010 (Pabpc4l)
   03041 Spliceosome [BR:rno03041]
    295010 (Pabpc4l)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     295010 (Pabpc4l)
   mRNA cycle factors
    Stress granule specific factors
     295010 (Pabpc4l)
Spliceosome [BR:rno03041]
 Complex C
  Other components
   Complex C specific factors
    295010 (Pabpc4l)
SSDB
Motif
Pfam: RRM_1 RRM_5 RRM_7 Nup35_RRM_2 Nup35_RRM RRM_occluded Ham1p_like RB_A
Other DBs
NCBI-GeneID: 295010
NCBI-ProteinID: NP_001099899
RGD: 1559517
Ensembl: ENSRNOG00000029749
UniProt: D3ZGA4
Position
2
AA seq 370 aa
MSVETKYRAASLYVGDLHEDVTEDLLFRKFNTVGPVLSIRICRDLISHRSLGYGYVNFLQ
VGDAQKALETMNFDLIKGKSIRLMWSQRDACLRKSGIGNVFIKNLDKSIDNKTLYEHFSP
FGKIMSSKVMTDEEGSKGYGFVHYQDQRAADRAIEEMNGKLLRDSTLFVARFKSRKDREA
ELREKPAEFTNVYIKNFGDDMDDESLRSVFSKYGQTLSVKVMKDASGKSKRFGFVSFDSH
KAAKNAVEDMNGRDINGQTIFVGRAQKKVERQAELKEMFEQMKKERIRARQAAKLYIKNL
DDTIDDETLRKEFSVFGSICRVKVMQEAGQSKGFGLICFFSPEAAAKAMAEMNGRILGSK
PLNIALGQKH
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgagtgtggaaactaagtaccgtgcggcttccctgtatgtgggtgacctccacgaagat
gtcacggaggaccttctgttcaggaagttcaacacagtaggacctgtgttgtccatccga
atctgcagggacctgatttcccatcgttcactaggctacggctatgtcaattttctccag
gtgggtgatgcccagaaggccctagaaactatgaactttgacttgatcaaaggtaaatcc
atccgtctcatgtggtctcaacgggatgcttgcctaaggaagtcgggaatcgggaatgtg
tttatcaagaatctggacaaatccattgacaacaaaaccttgtatgaacacttctcacct
ttcggaaagatcatgtcctccaaggtgatgactgatgaagaaggctccaagggttacggc
ttcgtgcactaccaggaccagagagcagctgacagggccattgaggagatgaatgggaag
ctgctgagggacagcactttgttcgtggccagattcaaaagccgtaaggatcgggaggct
gagctcagagagaaacccgccgaattcactaatgtgtatatcaaaaattttggggatgac
atggacgatgagagcctcaggtcagttttcagcaaatacggccaaactttgagcgttaag
gtgatgaaagatgcctctggcaagtccaaacgctttggatttgtgagctttgatagccac
aaggctgcgaaaaacgcagttgaggacatgaatgggcgggacataaacgggcagacaatt
tttgtaggcagagcccagaagaaggtggaaagacaggcggagttaaaggaaatgtttgag
caaatgaaaaaggaaagaatccgtgcccgccaggcagctaagctctacattaagaacctg
gatgacaccatcgatgatgaaacactgcgcaaggaattttctgtctttgggtccatttgc
agagttaaagtgatgcaggaagcagggcagagcaaagggtttggcttgatctgcttcttc
tccccggaggcagctgctaaagcaatggctgagatgaatggccgcatcctgggctccaaa
cccctcaacattgcactgggtcagaagcactga

KEGG   Rattus norvegicus (rat): 296351
Entry
296351            CDS       T01003                                 

Gene name
Pabpc1l
Definition
(RefSeq) polyadenylate-binding protein 1-like
  KO
K13126  polyadenylate-binding protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno03015  mRNA surveillance pathway
rno03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    296351 (Pabpc1l)
   03015 mRNA surveillance pathway
    296351 (Pabpc1l)
  09123 Folding, sorting and degradation
   03018 RNA degradation
    296351 (Pabpc1l)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    296351 (Pabpc1l)
   03041 Spliceosome [BR:rno03041]
    296351 (Pabpc1l)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     296351 (Pabpc1l)
   mRNA cycle factors
    Stress granule specific factors
     296351 (Pabpc1l)
Spliceosome [BR:rno03041]
 Complex C
  Other components
   Complex C specific factors
    296351 (Pabpc1l)
SSDB
Motif
Pfam: RRM_1 PABP RRM_5 RRM_7 RRM_occluded Limkain-b1
Other DBs
NCBI-GeneID: 296351
NCBI-ProteinID: XP_038962521
RGD: 1563142
Ensembl: ENSRNOG00000012750
Position
3
AA seq 669 aa
MDTRGHGCSLSSLYVGDLHPDVTEAMLYEMFSPIGTILSIRVCRDVATRRSLGYAYINFQ
QPADAERALDTMNFEMIKGQPIRIMWSHRDPGLRRSGMGNIFIKNLENSIDNKALYDTFS
TFGSILSSKVVYNEHGSRGFGFVHFETHEAAQKAINTMNGMLLNDRKVFVGHFKSRQKRE
AELGARALGFTNIYVKNLRVDMDEQGLQDLFSQFGKTQSVKVMRDSNGQSRGFGFINFEK
HEEAQKAVDHMNGKEVSGQLLYVGRAQKRAERQNELKRRFEQMKQERQNRYQGVNLYVKN
LDDSINDDRLKEVFSTYGVITSAKVMTESSHSKGFGFVCFSSPEEATKAVTEMNGRIVGT
KPLYVALAQRKEERKAILTNQYRRRLSRSVLSSFQQPTSYLLPAVHQVTGCLQLRLREQN
VTDRGSVEMTLDKLLQSLKASFDLSLEGPTCFLVFLELLTSDPLPPQSTTQTMYYSSASI
APMQPDPRWTAQPHGPSSTCPPAASVVQPLSTAPHPCIHLSSASQASSQVPHTQRVVNIG
TQTTGPGGEGSCIPGQPLLAHRGSSAVHSAHGVQESTVYVPGHQPLTVSMLDAAPLHEQK
QMIGERLYSLIHDACAPLTGKITGMLLEMDNLELLLLLESPESLHAKIEEAVAVLKAHRA
MESADSYRN
NT seq 2010 nt   +upstreamnt  +downstreamnt
atggacaccaggggccacggctgctcactctcctcgctctatgtgggcgatctgcacccc
gacgtgaccgaagctatgctctatgagatgttctcccccatcggcactattctttccatc
cgtgtgtgtcgggacgtggccacccggcgctctctgggctatgcctatatcaacttccag
cagcctgctgacgcggagcgggcactggacacgatgaactttgagatgatcaaaggccag
cccatccgaatcatgtggtcccacagagacccaggccttcgaaggtccggtatgggcaac
atctttatcaaaaacttggagaattccattgacaacaaggctctgtatgacaccttctcc
acctttgggagcatcctgtcttctaaggtggtatacaatgagcatggatcacggggtttc
ggctttgtgcattttgagacccacgaggctgcccagaaggccatcaacaccatgaatggg
atgttgctgaatgaccggaaagttttcgtaggtcacttcaagtctcgccagaagcgggag
gcagagctgggggctcgggccctaggattcaccaacatctatgtgaagaacctgcgcgtg
gacatggatgagcagggcctccaggacctcttctcccagtttggaaagacgcagagtgtg
aaggtgatgagagacagcaatgggcagtcccggggcttcggcttcatcaactttgagaag
catgaggaagcccagaaggctgtggaccacatgaatgggaaggaggtgagcgggcagctg
ctctatgtgggccgggcccagaagcgggcagagcggcagaacgagctgaagcgcagattt
gaacaaatgaagcaggagaggcagaaccgctaccagggtgtgaacctttatgtgaagaac
ctggatgactccattaatgatgataggctgaaggaagttttttctacctatggagtgatc
accagcgctaaggtgatgacagaaagtagccacagcaagggctttggctttgtgtgcttt
tcctctccagaagaggcaacgaaggctgtgacagagatgaacgggcgcatcgtgggtacg
aaaccactgtatgtggccctggcacagcgcaaggaggagcggaaggccatcttgaccaac
cagtataggagacgcctctctcgctctgtcttgagctccttccagcagcctaccagctac
ctgctccctgctgtacaccaggtgacaggatgtctccagctccggctgagggaacagaac
gtcacagacagaggttctgttgaaatgaccttggacaagctgctccaatcccttaaagcc
tcatttgatctgtctttagaggggcctacatgctttcttgtcttcttggagctcctcacc
tcggatcctcttcctccacagtctacaacccagactatgtactatagttctgcctccata
gccccaatgcaacctgaccccaggtggacagcccagcctcatggaccttcatctacctgc
cctccagctgcctcggtggtccagcctctaagcacggcaccgcacccctgtatccacctc
agcagtgccagccaggcctccagccaggtgcctcacacgcagagagtagttaacattggt
acccagactacaggaccaggtggggagggatcctgtattccaggccagcctcttttggca
catagaggatcctccgctgtacacagtgcccatggggtccaggagtcgaccgtgtatgtc
cctggccatcagcctctgactgtgtccatgctggatgctgcacccctgcatgagcaaaag
cagatgatcggggagcgtctctactcccttatccacgatgcctgcgccccactgactggc
aagatcacgggcatgctgctggagatggacaacctggagcttctgttattgttggagtcc
ccagagtccctccacgccaagatagaagaggccgtggcagtactgaaggcacatcgggca
atggagtcagcagacagttacaggaactga

KEGG   Rattus norvegicus (rat): 298510
Entry
298510            CDS       T01003                                 

Gene name
Pabpc4
Definition
(RefSeq) polyadenylate-binding protein 4
  KO
K13126  polyadenylate-binding protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno03015  mRNA surveillance pathway
rno03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    298510 (Pabpc4)
   03015 mRNA surveillance pathway
    298510 (Pabpc4)
  09123 Folding, sorting and degradation
   03018 RNA degradation
    298510 (Pabpc4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    298510 (Pabpc4)
   03041 Spliceosome [BR:rno03041]
    298510 (Pabpc4)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     298510 (Pabpc4)
   mRNA cycle factors
    Stress granule specific factors
     298510 (Pabpc4)
Spliceosome [BR:rno03041]
 Complex C
  Other components
   Complex C specific factors
    298510 (Pabpc4)
SSDB
Motif
Pfam: RRM_1 PABP RRM_7 RRM_5 RRM_occluded RRM_3 ApbA_C
Other DBs
NCBI-GeneID: 298510
NCBI-ProteinID: NP_001094008
RGD: 1305015
Ensembl: ENSRNOG00000015642
UniProt: G3V9N0
Position
5
AA seq 644 aa
MNAAASSYPMASLYVGDLHSDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQ
QPADAERALDTMNFDVIKGKPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKALYDTFS
AFGNILSCKVVCDENGSKGYAFVHFETQEAANKAIEKMNGMLLNDRKVFVGRFKSRKERE
AELGAKAKEFTNVYIKNFGEEVDDENLRELFSQFGKTLSVKVMRDCSGKSKGFGFVSYEK
HEDANKAVEEMNGKEMSGKSIFVGRAQKKVERQAELKRKFEQLKQERISRYQGVNLYIKN
LDDTIDDEKLRKEFSPFGSITSAKVMLEDGRSKGFGFVCFSSPEEATKAVTEMNGRIVGS
KPLYVALAQRKEERKAHLTNQYMQRVAGMRALPANAILNQFQPAAGGYFVPAVPQAQGRP
PYYTPNQLAQMRPNPRWQQGGRPQGFQGMPSALRQSGPRPALRHLAPTGSECPDRLAMDF
GGAGAAQQGLTDSCQSGGVPTAVPNLAPRATVAAAAPRAVAPYKYASNVRSPHPAIQPLQ
APQPAVHVQGQEPLTASMLAAAPPQEQKQMLGERLFPLIQTMHSNLAGKITGMLLEIDNS
ELLHMLESPESLRSKVDEAVAVLQAHHAKKEAAQKVGTVAAATS
NT seq 1935 nt   +upstreamnt  +downstreamnt
atgaacgctgcggccagcagctaccccatggcctccttatacgtgggcgatctgcactcc
gatgtcaccgaagccatgctgtatgaaaagttcagccctgcggggcctgtgctgtccatc
cgggtctgccgcgatatgatcacccgccgctctctgggttatgcctacgtcaacttccag
cagccagctgacgctgagagggccttggacaccatgaactttgatgtgattaaggggaag
ccaatccggatcatgtggtctcagagggacccctctttgaggaagtctggtgtgggaaat
gtcttcatcaagaacctggacaagtctatagacaacaaggcactgtatgacactttctct
gccttcggaaacatcctgtcctgtaaggtggtctgtgatgagaacggctctaagggttat
gcctttgtccacttcgagacccaagaggctgccaacaaggccatcgagaagatgaatggc
atgctcctcaatgaccgcaaagtgttcgtgggcagattcaagtctcgcaaagagcgggaa
gccgagcttggagccaaggccaaggaattcaccaatgtttatatcaaaaactttggagaa
gaggtggatgatgagaatctgagggagctattcagccagtttggtaagaccttaagtgtc
aaggtgatgagagactgcagtgggaagtccaaaggcttcggcttcgtgagctatgagaaa
catgaggatgccaataaggctgtggaagaaatgaatggaaaagaaatgagtgggaaatcc
atatttgtaggccgtgctcagaaaaaagtagaacgtcaggcggagttaaaacggaaattc
gaacagctgaagcaggagaggattagtcggtaccagggagtgaatctctacattaagaac
ttggatgacaccattgacgatgagaagttaaggaaagagttctcaccctttggatcaatc
accagtgcgaaggtgatgctggaagacgggagaagcaaagggtttggctttgtctgtttc
tcctctcctgaagaggcaaccaaagcggtcacggagatgaacggacgcattgtgggctcc
aagcctctgtacgtcgccctggcccagaggaaggaggagcggaaggctcacctgactaac
cagtatatgcagcgtgtggcaggaatgagagcgctccctgccaacgccatcttaaatcag
ttccagcctgcagctggtggctactttgtgccggcagtgccacaggcccagggaagacct
ccatattacacacctaatcaattagcgcaaatgaggcctaatccacgctggcagcaaggc
gggagacctcaaggcttccaaggaatgccaagtgccctgcggcaatctgggcctcgtcca
gctcttcggcatctggctccaactgggtctgagtgcccggaccgcttggctatggacttt
ggtggggctggtgccgcccagcaagggctgactgacagctgccagtctggaggcgtccct
acggctgtgccaaaccttgcacctcgtgctacagtcgctgctgctgctcccagggctgtg
gctccatacaagtatgcctccaatgtccgcagccctcaccctgccattcagccgctgcag
gccccccagcctgcagtccatgtccagggtcaagaacccctgactgcctccatgctggct
gcagctcctccccaggagcagaagcagatgctgggggagcgtttgttcccacttatccaa
acaatgcattcaaacctggctggaaaaattacagggatgctgctagaaatcgacaactct
gagctgctccacatgctggagtcccccgagtccctccgttccaaggtggatgaagctgtg
gcagtcctgcaggctcatcatgccaagaaagaagctgcccagaaggtgggcactgttgct
gctgctacctcttaa

KEGG   Rattus norvegicus (rat): 302405
Entry
302405            CDS       T01003                                 

Gene name
Pabpc1l2a
Definition
(RefSeq) polyadenylate-binding protein 1-like 2
  KO
K13126  polyadenylate-binding protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno03015  mRNA surveillance pathway
rno03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    302405 (Pabpc1l2a)
   03015 mRNA surveillance pathway
    302405 (Pabpc1l2a)
  09123 Folding, sorting and degradation
   03018 RNA degradation
    302405 (Pabpc1l2a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    302405 (Pabpc1l2a)
   03041 Spliceosome [BR:rno03041]
    302405 (Pabpc1l2a)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     302405 (Pabpc1l2a)
   mRNA cycle factors
    Stress granule specific factors
     302405 (Pabpc1l2a)
Spliceosome [BR:rno03041]
 Complex C
  Other components
   Complex C specific factors
    302405 (Pabpc1l2a)
SSDB
Motif
Pfam: RRM_1 RRM_5 Nup35_RRM RRM_7
Other DBs
NCBI-GeneID: 302405
NCBI-ProteinID: XP_006257212
RGD: 1566367
Ensembl: ENSRNOG00000022267
Position
X
AA seq 229 aa
MDEELAAALAAEEEEAAAGGSDDGNPDFPTASLYVGDLHPEVTESMLYEKFSPAGPILSI
RLCRDKVTRRSLGYAYVNYQQPVDAKRALETMNFDVINGRPVRIMWSQRDPSLRKSGVGN
VFIKNLGKTIDNKALYNIFSAFGNILSCKVACDEKGPKGYGFVHFQKQESAERAIDALNG
MFLNYRKIFVGRFKSHKEREAERGAWARQSTSADFKDFDDDSDDEATFR
NT seq 690 nt   +upstreamnt  +downstreamnt
atggacgaagagctggcggcggccttggctgcagaagaggaggaggcggcggccgggggc
tcggacgatgggaacccagactttcccacggcctcgctgtacgtgggcgacctgcacccc
gaggtgaccgagtccatgctgtatgagaagttcagccccgccgggcccatcctgtccatc
cgcctgtgccgggacaaggtcacccggcgctctctgggctacgcatatgtcaactaccag
caaccggtggacgccaagcgggccctggagaccatgaactttgacgttataaatggcagg
ccagtgcgcatcatgtggtcccagagggacccgtcgctccgcaagagcggggtgggcaac
gtcttcatcaagaacctgggcaagaccatcgacaacaaggcgctgtacaacatcttctcg
gcctttggcaacatcctgtcctgcaaggtggcctgtgacgaaaaggggcccaagggctac
gggttcgtgcacttccagaagcaggagtcggccgagcgggccatagatgcgctgaatggc
atgttcctgaactaccgcaagattttcgtggggagattcaagtcccacaaggagagggag
gccgaaaggggagcctgggcccgccagtccaccagcgctgacttcaaggatttcgacgac
gactcggatgacgaggccaccttccgatga

KEGG   Rattus norvegicus (rat): 688518
Entry
688518            CDS       T01003                                 

Gene name
Pabpc5
Definition
(RefSeq) polyadenylate-binding protein 5
  KO
K13126  polyadenylate-binding protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno03015  mRNA surveillance pathway
rno03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    688518 (Pabpc5)
   03015 mRNA surveillance pathway
    688518 (Pabpc5)
  09123 Folding, sorting and degradation
   03018 RNA degradation
    688518 (Pabpc5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    688518 (Pabpc5)
   03041 Spliceosome [BR:rno03041]
    688518 (Pabpc5)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     688518 (Pabpc5)
   mRNA cycle factors
    Stress granule specific factors
     688518 (Pabpc5)
Spliceosome [BR:rno03041]
 Complex C
  Other components
   Complex C specific factors
    688518 (Pabpc5)
SSDB
Motif
Pfam: RRM_1 RRM_5 RRM_occluded RRM_7 RRM_3
Other DBs
NCBI-GeneID: 688518
NCBI-ProteinID: NP_001103836
RGD: 1587661
Ensembl: ENSRNOG00000003354
UniProt: D4A5H0
Position
X
AA seq 382 aa
MGSGEPNTAGKKKKYLKAALYVGDLDPDVTEDMLYKKFRPAGPLRFTRICRDPVTRSPLG
YGYVNFRFPADAEWALNTMNFDLINGKPFRLMWSQPDDHLRKSGVGNIFIKNLDKSIDNR
ALFYLFSAFGNILSCKVVCDDNGSKGYAYVHFDSLAAANRAIWHMNGVRLNNRQVYVGRF
KFPEERAAEVRTRDRATFTNVFVKNFGDDIDDEKLKKLFSEYGPTESVKVIRDATGKSKG
FGFVRYETHEAAQKAVLELHGKSIDGKVLCVGRAQKKIERLAELRRRFERLKLKDKTRPP
GVPIYIKNLDETINDEKLKEEFSLFGSISRAKVMMEVGQGKGFGVVCFSSFEEASKAVNE
MNGRVVGSKTLHVTLGQARHRW
NT seq 1149 nt   +upstreamnt  +downstreamnt
atggggagtggggagcctaatactgctggcaagaaaaagaagtacctcaaggctgccctg
tatgtaggtgacttggatcctgatgtcacagaggacatgctctataagaagttcagacct
gctggcccactgcgcttcactagaatctgccgtgacccagtgacccgcagccccctgggt
tatggttatgttaacttccgctttcctgcagatgctgaatgggcgttgaacaccatgaat
tttgatttaattaatggtaaaccatttcgcctcatgtggtcacagccagatgaccactta
agaaagtctggagttggaaatatattcatcaaaaacttggataaatccatagacaatagg
gccctattttatttattttctgctttcgggaacattctttcctgtaaagtcgtatgtgat
gacaatggctctaagggttatgcttatgttcacttcgatagccttgctgctgccaatagg
gctatctggcacatgaatggagtccggctcaataaccgccaggtatatgttggccgattc
aaatttcctgaagagagagcagcagaagtcagaaccagagatagagcgacatttaccaat
gtttttgtgaaaaactttggtgatgacatagatgatgaaaaactaaagaaacttttcagt
gaatatgggccaactgagagtgttaaagtaataagagacgccactgggaaatctaaaggc
ttcggatttgtaagatatgaaacacatgaagctgcccaaaaggctgtgctagaactacat
ggcaagtcaatagatggaaaagtcctatgtgtagggagagcacagaagaaaattgaacgc
ctggctgaattaaggcggagatttgaacggctgaaactaaaagataaaactaggcctcca
ggagtgcctatctacattaagaacttagatgagacaatcaatgatgagaaactaaaggag
gaattctctttatttggatcaataagtcgggccaaagtgatgatggaagtggggcaaggc
aaaggttttggtgttgtctgcttttcttcttttgaagaagcttccaaagcagtgaatgag
atgaatggtcgtgtagtaggctccaagacattgcatgtcactctggggcaagccaggcac
aggtggtga

DBGET integrated database retrieval system