KEGG   Rattus norvegicus (rat): 171360
Entry
171360            CDS       T01003                                 

Gene name
Vsx2, Chx10
Definition
(RefSeq) visual system homeobox 2
  KO
K09336  visual system homeobox protein 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    171360 (Vsx2)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Prd
    171360 (Vsx2)
SSDB
Motif
Pfam: Homeodomain OAR Homeobox_KN Malate_DH
Other DBs
NCBI-GeneID: 171360
NCBI-ProteinID: NP_001162599
RGD: 621215
Ensembl: ENSRNOG00000011918
UniProt: G3V7K0
Position
6q31
AA seq 361 aa
MTGKAGEALSKPKSETVAKSTSGGAPARCTGFGIQEILGLNKEPPSSHPRAALDGLAPGH
LLAARSVLSPAGVGSMGLLGPGGLPGFYAQPTFLEVLSDPQSVHLQPLGRASGPLDTSQT
ASSDSEDVSSSDRKMSKSALNQTKKRKKRRHRTIFTSYQLEELEKAFNEAHYPDVYAREM
LAMKTELPEDRIQVWFQNRRAKWRKREKCWGRSSVMAEYGLYGAMVRHSIPLPESILKSA
KDGIMDSCAPWLLGMHKKSLEAAAESGRKPEVERQVLPKLDKMEQEERAPDAQAAISQEE
LRENSIAALRAKAQEHSTKVLGTVSGPDGLARNAEKPEEEEAMDEDRPAEKLSPPQLEDM
A
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgacggggaaagcgggggaagcgctgagcaagcctaaatccgagacagtggccaagagt
acctcggggggtgccccggccaggtgcacagggttcggcatccaggagatcctaggcttg
aacaaggagcctcccagctcccacccgcgggctgccctggacggcctggcccccgggcat
ttgttagctgcgcgctctgttctcagccccgcaggagtgggcagcatggggctgctgggg
cccggagggcttcccggcttctacgcacagcccaccttcctggaagtgctgtccgatccg
cagagcgtccacttgcagccactaggcagagcgtcggggccgctggacaccagccagacg
gccagctccgattccgaagatgtttcctccagtgaccgaaaaatgtccaaatcggcttta
aaccagaccaagaaacgtaagaagcggcgacacaggacaatctttacttcctaccagcta
gaggagctggagaaggcattcaatgaagcccactacccagatgtctacgcccgggagatg
ctggccatgaaaacggagctaccagaagacaggatacaggtgtggttccagaaccgcaga
gccaaatggaggaagagggagaagtgctggggccggagcagcgtcatggctgagtacggc
ctctatggagccatggtgaggcactccatccccctgccagagtccatcctcaagtcggcc
aaggacggcatcatggattcctgcgccccttggctactggggatgcacaaaaagtcgctg
gaggcagcagccgagtccggaaggaagcccgaggtggaacgccaggtcctgcccaaactc
gacaagatggagcaggaggaaagggccccggatgctcaggcagccatctcccaggaagaa
ctgagggagaacagcattgcggccctccgagccaaagctcaggagcacagcaccaaggtt
ctggggactgtatccgggcctgacggcctagccaggaatgctgagaagccagaagaggag
gaagccatggacgaagacaggccagcagagaagctcagcccaccgcagctggaggacatg
gcttag

DBGET integrated database retrieval system