KEGG   Rattus norvegicus (rat): 171361
Entry
171361            CDS       T01003                                 

Symbol
Eef1a1
Name
(RefSeq) elongation factor 1-alpha 1
  KO
K03231  elongation factor 1-alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  Nucleocytoplasmic transport
rno05134  Legionellosis
rno05140  Leishmaniasis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    171361 (Eef1a1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    171361 (Eef1a1)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    171361 (Eef1a1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    171361 (Eef1a1)
   03016 Transfer RNA biogenesis [BR:rno03016]
    171361 (Eef1a1)
   03012 Translation factors [BR:rno03012]
    171361 (Eef1a1)
   04131 Membrane trafficking [BR:rno04131]
    171361 (Eef1a1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    171361 (Eef1a1)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Trans-acting binding proteins
     171361 (Eef1a1)
Transfer RNA biogenesis [BR:rno03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    171361 (Eef1a1)
Translation factors [BR:rno03012]
 Eukaryotic type
  Elongation factors
   171361 (Eef1a1)
Membrane trafficking [BR:rno04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Other CMA associated proteins
    171361 (Eef1a1)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   171361 (Eef1a1)
SSDB
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 GTP_EFTU_D4 Gtr1_RagA G-alpha
Other DBs
NCBI-GeneID: 171361
NCBI-ProteinID: NP_787032
RGD: 67387
Ensembl: ENSRNOG00000009439
UniProt: P62630
Position
8
AA seq 462 aa
MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL
DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV
GEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKK
IGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGSASGTTLLEALDCILPPTR
PTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALS
EALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPV
LDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPP
LGRFAVRDMRQTVAVGVIKAVDKKAAGAGKVTKSAQKAQKAK
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgggaaaggaaaagactcacatcaacatcgtcgtaattggacacgtagattccggcaag
tccaccacaaccggccacctgatctacaaatgtggtggaatcgacaaaagaaccattgaa
aagtttgagaaggaggctgcggagatgggaaaaggctccttcaagtatgcctgggtcctg
gacaaactgaaagctgagcgtgagcgtggtatcactattgacatctccctgtggaagttt
gagaccagcaagtactatgtgactatcattgatgccccaggacacagagacttcatcaag
aacatgattacgggcacatctcaggctgactgcgctgtcctgattgttgctgctggtgtt
ggggaatttgaagctggtatctccaagaacgggcagacccgtgagcatgctcttctggct
tacactttgggtgtgaaacagctaattgttggtgtcaacaaaatggattccaccgagcca
ccatacagtcagaagagatacgaggaaatcgttaaggaagtcagcacctacattaagaaa
attggctacaaccctgacacagtagcatttgtgccaatttctggttggaatggtgacaac
atgctggagccaagtgctaatatgccgtggttcaagggatggaaagtcacccgcaaagat
ggcagtgccagtggcaccacgctgctggaagctttggactgcattctgccgccaactcgt
ccaactgacaagcctctgcgactgcccctccaggatgtctataaaattggcggcattggc
actgtccctgtgggccgagtggaaactggtgttctcaaacctggtatggtggttaccttt
gctccagtcaatgtaacaactgaagtcaagtctgtggaaatgcaccatgaagctttgagt
gaagctctgcctggggacaatgtaggcttcaacgtaaagaacgtgtctgtcaaagacgtt
agacgtggcaatgttgctggggacagcaaaaatgacccaccaatggaagcagctggcttc
actgctcaggtgattatcctgaaccatccaggccagatcagtgctggctatgcccctgtt
ctggactgccacacggcccacatagcatgcaagtttgccgagcttaaagagaagatcgat
cgtcgttctggtaagaagctggaagatggccccaaattcttgaagtctggtgatgctgcc
attgttgacatggtccctggcaagcccatgtgtgttgaaagcttctctgactaccctcca
cttggtcgttttgctgttcgtgacatgaggcagacagttgctgtgggtgtcatcaaagcc
gtggacaagaaggctgcaggagctggcaaagtcaccaagtctgcccagaaagctcagaag
gctaaatga

DBGET integrated database retrieval system