KEGG   Rattus norvegicus (rat): 171366Help
Entry
171366            CDS       T01003                                 

Gene name
Ppp4c, Ppx
Definition
(RefSeq) protein phosphatase 4, catalytic subunit
  KO
K15423  serine/threonine-protein phosphatase 4 catalytic subunit [EC:3.1.3.16]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04922  Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    171366 (Ppp4c)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:rno01009]
    171366 (Ppp4c)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    171366 (Ppp4c)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     171366 (Ppp4c)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-4
    Catalytic subunits
     171366 (Ppp4c)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Protein phosphatase 4
     171366 (Ppp4c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallophos STPPase_N Metallophos_2
Motif
Other DBs
NCBI-GeneID: 171366
NCBI-ProteinID: NP_599186
RGD: 621225
Ensembl: ENSRNOG00000019813
UniProt: Q5BJ92
Position
1q36
AA seq 307 aa AA seqDB search
MAEISDLDRQIEQLRRCELIKESEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFY
DLKELFRVGGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQI
TQVYGFYDECLRKYGSVTVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQTLDQIRTI
DRKQEVPHDGPMCDLLWSDPEDTTGWGVSPRGAGYLFGSDVVAQFNAANDIDMTCRAHQL
VMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKK
PVADYFL
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaatcagcgacctggaccggcagatcgagcagctgcggcgctgcgaacttatc
aaagagagcgaagtcaaggccctgtgcgctaaggccagagagatcttggtagaagagagc
aacgtgcagagggtggactcgccagtcacagtatgcggtgacatccacggacaattctat
gacctcaaggagctgttcagagtaggtggcgatgtccctgagaccaactacctcttcatg
ggagactttgtggaccgtggtttctacagtgttgaaaccttcctcctcctgctggctctt
aaggttcgatatcctgaccgaatcactttgatccggggcaatcatgagagtcgccagatt
acccaggtctatgggttctatgatgagtgcttacggaaatatggttcagtgactgtatgg
cgctactgtactgagatctttgactacctcagcctgtctgccatcattgatggcaagatc
ttctgtgtgcatggaggtctttccccttctatccagaccttggaccagatccggacaatt
gaccgaaagcaagaggtaccccatgatggacccatgtgtgacctcctgtggtctgaccct
gaagacacaacaggctggggagtgagcccccgtggggcaggctacctgtttggcagtgat
gtggtcgcccagttcaatgcagccaacgacattgatatgacctgccgtgcccaccaattg
gtgatggaaggttacaagtggcacttcaatgagacggtgcttactgtgtggtcagcgcct
aattactgctaccgctgtgggaatgtggcagccatcttagaactggatgagcacctccag
aaagatttcatcatcttcgaggctgcaccccaagagacacgtggcatcccctccaaaaag
ccagtggctgactatttcctgtga

DBGET integrated database retrieval system