KEGG   Rattus norvegicus (rat): 171369Help
Entry
171369            CDS       T01003                                 

Gene name
Cd40, Tnfrsf5
Definition
(RefSeq) CD40 molecule
  KO
K03160  tumor necrosis factor receptor superfamily member 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04064  NF-kappa B signaling pathway
rno04514  Cell adhesion molecules (CAMs)
rno04620  Toll-like receptor signaling pathway
rno04672  Intestinal immune network for IgA production
rno05144  Malaria
rno05145  Toxoplasmosis
rno05166  Human T-cell leukemia virus 1 infection
rno05169  Epstein-Barr virus infection
rno05202  Transcriptional misregulation in cancer
rno05310  Asthma
rno05320  Autoimmune thyroid disease
rno05322  Systemic lupus erythematosus
rno05330  Allograft rejection
rno05340  Primary immunodeficiency
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    171369 (Cd40)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    171369 (Cd40)
   04514 Cell adhesion molecules (CAMs)
    171369 (Cd40)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    171369 (Cd40)
   04672 Intestinal immune network for IgA production
    171369 (Cd40)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    171369 (Cd40)
  09163 Immune disease
   05310 Asthma
    171369 (Cd40)
   05322 Systemic lupus erythematosus
    171369 (Cd40)
   05320 Autoimmune thyroid disease
    171369 (Cd40)
   05330 Allograft rejection
    171369 (Cd40)
   05340 Primary immunodeficiency
    171369 (Cd40)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    171369 (Cd40)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    171369 (Cd40)
   05169 Epstein-Barr virus infection
    171369 (Cd40)
  09174 Infectious disease: parasitic
   05144 Malaria
    171369 (Cd40)
   05145 Toxoplasmosis
    171369 (Cd40)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rno04050]
    171369 (Cd40)
   04090 CD molecules [BR:rno04090]
    171369 (Cd40)
Cytokine receptors [BR:rno04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   171369 (Cd40)
CD molecules [BR:rno04090]
 Proteins
  171369 (Cd40)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNFR_c6 TMEM154
Motif
Other DBs
NCBI-GeneID: 171369
NCBI-ProteinID: NP_599187
RGD: 619830
Ensembl: ENSRNOG00000018488
UniProt: Q4QQW2
Position
3q42
AA seq 289 aa AA seqDB search
MLPLPQLCALWGCLLTAVHLGQCVTCSDKQYLQGGECCDLCQPGNRLVSHCTALEKTQCQ
PCDSGEFSAHWNREIRCHQHRHCELNQGLQVKKEGTAVSDTVCTCKEGQHCASKECETCA
QHTPCGPGFGVVQMATETTDTVCQPCPVGFFSNGSSLFEKCHPWTSCEDQKLMVLREGTS
QTDTLCGFQPRMRALLVIPVVMVILITIFVVFLYIKKVVKKPKDNEVLPPEARGQDPVEI
EDYPGHNTAAPVQETLHGCQPVAQEDGKESRISVQERQVTGSMALKPLV
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgctgcctttgcctcagctgtgcgcgctctggggctgcttgttgacagcggtccatcta
ggacagtgtgttacgtgcagtgacaaacagtacctccaaggtggcgagtgctgcgatttg
tgccagccgggaaaccgactagttagccactgcacagctcttgagaagacccaatgccaa
ccgtgcgactcaggcgaattctcagctcactggaacagggagatccgctgccaccagcac
cgacactgcgaactcaatcaagggcttcaggttaagaaggagggcaccgcggtttcagac
actgtttgtacctgcaaggaagggcagcactgcgccagcaaggagtgcgagacgtgcgct
cagcacacgccctgtggccctggctttggagtcgtgcagatggccactgagactactgat
actgtctgccaaccctgcccggtcggattcttctccaatgggtcatcactttttgaaaag
tgtcatccatggacaagctgtgaagatcagaagctgatggtcctacgggaaggaacaagt
cagactgataccctctgtggtttccagccccggatgcgagccctgctggtcattcccgtc
gtgatggtcatcctcatcaccatctttgtggtttttctctatatcaaaaaggtggtcaag
aaaccaaaggacaatgaggtcttaccccctgaggctcgaggacaagatcctgtggagata
gaagattatcccggtcacaacactgctgctccagtgcaggagacgttgcatgggtgtcag
cctgttgcacaggaggatggtaaagagagtcgcatctcagtgcaggagcggcaggtgaca
ggcagcatggccttgaagcccctggtctga

DBGET integrated database retrieval system