KEGG   Rattus norvegicus (rat): 171371Help
Entry
171371            CDS       T01003                                 

Gene name
Xcl1, Ltn, Scyc1
Definition
(RefSeq) X-C motif chemokine ligand 1
  KO
K05507  C motif chemokine 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    171371 (Xcl1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    171371 (Xcl1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    171371 (Xcl1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    171371 (Xcl1)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   171371 (Xcl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 171371
NCBI-ProteinID: NP_599188
RGD: 620452
Ensembl: ENSRNOG00000002964
UniProt: P51672
Position
13q23
AA seq 114 aa AA seqDB search
MRLLLLTFLGVCCFAAWVVEGVGTEVLQESICVSLRTQRLPVQKIKTYTIKEGAMRAVIF
VTKRGLRICADPQAKWVKTAIKTVDGRASASKSKAETIPTQAQRSASTAVTLTG
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgagacttctcctcctgactttcctgggagtctgctgcttcgccgcatgggttgtggaa
ggtgtgggcactgaagtcctacaagagagtatctgtgtgagcttaagaacccagcggctg
ccagttcaaaaaatcaagacctacaccatcaaggagggagccatgagagctgtaattttt
gtcaccaaacgaggactaagaatttgtgctgatccacaagccaaatgggtgaaaacagcc
atcaaaaccgtagatggcagggccagtgccagcaagagcaaggctgaaactattcccaca
caagcccagaggtccgccagcacagcagtaaccctgactgggtaa

DBGET integrated database retrieval system